SAB1403361

Monoclonal Anti-LENG4 antibody produced in mouse

clone 1D4, purified immunoglobulin, buffered aqueous solution

• Sinónimos: BB1, LENG4, LPIAT, hMBOA-7
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1D4, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~36.78 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_024298
• Nº de acceso UniProt: Q96N66
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MBOAT7(79143)

Descripción

Descripción general

Membrane bound O-acyltransferase domain containing 7 (MBOAT7) or LENG4 belongs to membrane-bound O-acyltransferase family. The gene encoding it is localized on human chromosome 19q13.42.

Mouse monoclonal antibody raised against a partial recombinant LENG4.

Inmunógeno

LENG4 (NP_077274.2, 96 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEMASGFSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLL

Acciones bioquímicas o fisiológicas

Membrane bound O-acyltransferase domain containing 7 (MBOAT7) or LENG4 is an integral membrane protein important for reacylation of phospholipids. LENG4 is highly specific for arachidonoyl-coenzyme A and is involved in arachidonate recycling. It interacts with the small subunit of serine palmitoyltransferase a (ssSPTa). This interaction is important for LENG4-dependent incorporation of arachidonic acid into phosphatidylinositol.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable