Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

QPREST27836

Sigma-Aldrich

SILuPrEST ZCPW2

SILuPrESTs Powered by Atlas Antibodies, buffered aqueous solution

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352200

recombinant

expressed in E. coli LysA ArgA BL21(DE3)

assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 26kDa including tags

purified by

immobilized metal affinity chromatography (IMAC)

packaging

pkg of 1nmol × 5 vials

storage condition

avoid repeated freeze/thaw cycles

immunogen sequence

TATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... ZCPW2(152098)

General description

Lys, Arg 13C and 15N metabolically labeled recombinant human protein fragment

Application

Internal standard in MS-based quantitative proteomics

Physical form

Heavy proteins are provided in solution of 1M Urea PBS, pH 7.4

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Analysis Note

Isotopic Label Incorporation

The SILuPrEST standards are produced using metabolic labeling with heavy isotope labeled (15N, 13C) Lysine and Arginine residues, with greater than 99% isotopic label incorporation.
A purification and quantification tag (QTag) consisting of a hexahistidine (His6) sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G.
All SILuPrESTs contain an N-terminal His6ABP fusion tag, used for accurate determination of concentration. The fusion tag sequence is:

GSSHHHHHHSSGLVPRGSHMASLAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGTFAHYMDPNSSSVDKLAAA.

The specific human protein sequence begins directly after ′VDKLAAA′.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected]
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class

12 - Non Combustible Liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documentos section.

Si necesita más asistencia, póngase en contacto con Atención al cliente

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico