OGS3299
PSF-OXB20-NH2-TRX-TEV - N-TERMINAL TRX TAG BACTERIAL PLASMID
plasmid vector for molecular cloning
Sinónimos:
cloning vector, expression vector, molecular cloning vector, plasmid, plasmid vector, snapfast vector, vector
About This Item
recombinante
expressed in E. coli
etiqueta
TRX tagged
Formulario
buffered aqueous solution
mol peso
size 4205 bp
selección de bacterias
kanamycin
Origen de replicación
pUC (500 copies)
Escisión peptídica
TEV
Ubicación de la etiqueta en el péptido
N-terminal
Promotor
Promoter name: OXB20
Promoter activity: constitutive
Promoter type: bacterial
gen reportero
none
Condiciones de envío
ambient
temp. de almacenamiento
−20°C
Descripción general
About the Peptide Tag:This plasmid contains an n-terminal Thioredoxin (TRX) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is:SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGS.
About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.
Promoter Expression Level: This plasmid contains a constitutive bacterial promoter that does not require induction. It is the strongest bacterial promoter we sell and this can cause solubility and expression problems with some proteins. We also offer a range of other bacterial promoters that are compatible with this plasmid and are available on request.
Secuencia
Nota de análisis
Producto relacionado
Código de clase de almacenamiento
12 - Non Combustible Liquids
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documentos section.
Si necesita más asistencia, póngase en contacto con Atención al cliente
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico