Saltar al contenido
Merck

OGS2925

PSF-OXB20-COOH-3C-MBP-6HIS - C-TERMINAL 6 HIS AND MBP DUAL TAG BACTERIAL PLASMID

plasmid vector for molecular cloning

Sinónimos:

cloning vector, expression vector, molecular cloning vector, plasmid, plasmid vector, snapfast vector, vector

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño


Acerca de este artículo

NACRES:
NA.85
UNSPSC Code:
12352200
Promoter:
Promoter name: OXB20
Promoter activity: constitutive
Promoter type: bacterial
Origin of replication:
pUC (500 copies)
Bacteria selection:
kanamycin
Reporter gene:
none
Peptide cleavage:
3C
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle

recombinant

expressed in E. coli

tag

6-His tagged, maltose-binding protein (MBP) tagged

form

buffered aqueous solution

mol wt

size 5000 bp

bacteria selection

kanamycin

origin of replication

pUC (500 copies)

peptide cleavage

3C

peptide tag location

C-terminal

promoter

Promoter name: OXB20
Promoter activity: constitutive
Promoter type: bacterial

reporter gene

none

shipped in

ambient

storage temp.

−20°C

General description

This plasmid is designed to express tagged proteins in E. coli. The plasmid contains a constitutive promoter (OXB20) derived from the region upstream of the E. coli RecA gene. It does not require induction or any additional components for activity. It is the strongest of the bacterial promoters that we provide and this high level of expression can cause expression problems with some proteins with poor solubility. For this reason we sell a range of bacterial promoters with different expression levels (OXB1(low)>OXB20(high)) that can be provided with the peptide tags in this plasmid on request.

About the Peptide Tag:This plasmid contains a c-terminal Maltose Binding Protein (MBP) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS. This plasmid also contains a secondary Hexa-Histidine (6His) tag protein tag. The sequence of this tag is: HHHHHHWe provide a range of dual peptide tag plasmids. This is because some peptide tags provide specific biological properties (e. g., small molecule affinity new epitopes solubility or protein secretion) that are not provided by others.

About the Cleavage Tag: This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a 3C cleavage tag. The protein sequence of the cleavage tag is: LEVLFQGP. Human Rhinovirus (HRV) 3C Protease is a highly specific protease that cleaves between the Glu and Gly residues of its recognition site. It is often produced with the trademname ′PreScission protease′.

Promoter Expression Level: This plasmid contains a constitutive bacterial promoter that does not require induction. It is the strongest bacterial promoter we sell and this can cause solubility and expression problems with some proteins. We also offer a range of other bacterial promoters that are compatible with this plasmid and are available on request.

Analysis Note

To view the Certificate of Analysis for this product, please visit www.oxgene.com

Other Notes

To view sequence information for this product, please visit the product page

Clase de almacenamiento

12 - Non Combustible Liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documentos section.

Si necesita más asistencia, póngase en contacto con Atención al cliente

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Geoffrey M Lynn et al.
Nature biotechnology, 33(11), 1201-1210 (2015-10-27)
The efficacy of vaccine adjuvants such as Toll-like receptor agonists (TLRa) can be improved through formulation and delivery approaches. Here, we attached small molecule TLR-7/8a to polymer scaffolds (polymer-TLR-7/8a) and evaluated how different physicochemical properties of the TLR-7/8a and polymer
Diana Romero et al.
Carcinogenesis, 37(1), 18-29 (2015-10-28)
Dickkopf-3 (Dkk-3) is a secreted protein whose expression is downregulated in many types of cancer. Endogenous Dkk-3 is required for formation of acini in 3D cultures of prostate epithelial cells, where it inhibits transforming growth factor (TGF)-β/Smad signaling. Here, we
Jin-Gyoung Jung et al.
PLoS genetics, 10(10), e1004751-e1004751 (2014-10-31)
The Notch3 signaling pathway is thought to play a critical role in cancer development, as evidenced by the Notch3 amplification and rearrangement observed in human cancers. However, the molecular mechanism by which Notch3 signaling contributes to tumorigenesis is largely unknown.
Alexander C Cerny et al.
PLoS genetics, 11(10), e1005578-e1005578 (2015-10-29)
Recycling of signaling proteins is a common phenomenon in diverse signaling pathways. In photoreceptors of Drosophila, light absorption by rhodopsin triggers a phospholipase Cβ-mediated opening of the ion channels transient receptor potential (TRP) and TRP-like (TRPL) and generates the visual

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico