HPA038002
Anti-METTL14 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinónimos:
Anti-KIAA1627, Anti-Methyltransferase like 14
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500
immunogen sequence
RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... METTL14(57721)
General description
The gene METTL14 (methyltransferase like 14) is mapped to human chromosome 4q. It is a homologue of METTL3. The protein has an N-terminal α-helical motif (NHM), methyltransferase domain and a C-terminal motif.
Immunogen
methyltransferase like 14 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-METTL14 antibody produced in rabbit has been used in western blotting and immunofluorescence.
Anti-METTL14 antibody produced in rabbit has been used in western blotting and immunofluorescence.
Anti-METTL14 antibody produced in rabbit has been used in:
- cross-linking and RNA immunoprecipitation (CLIP)
- western blot
- immunohistochemical analysis
Biochem/physiol Actions
METTL14 (methyltransferase like 14) is mainly responsible for m6A (N6-methyladenosine) RNA methylation. It forms a heterodimer with METTL3 and the complex catalyzes m6A RNA methylation.
METTL14 mutation reduces m6A methylation in ~70% of endometrial tumors.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST79779
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Herramienta de selección de productos.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Array comparative genomic hybridization analysis identified the chromosomal aberrations and putative genes involved in prostate tumorigenesis of Malaysian men.
Saaid NN, et al.
Sains Malaysiana, 43, 1317-1326 (2014)
The m(6)A Methyltransferase METTL3 Promotes Translation in Human Cancer Cells.
Lin S, et al.
Molecular Cell, 62, 335-335 (2016)
N6-methyladenosine alters RNA structure to regulate binding of a low-complexity protein
Liu N, et al.
Nucleic Acids Research, 45(10), 6051-6063 (2017)
N(6)-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions.
Liu N, et al.
Nature, 518, 560-560 (2015)
Veronika A Herzog et al.
Nature methods, 14(12), 1198-1204 (2017-09-26)
Gene expression profiling by high-throughput sequencing reveals qualitative and quantitative changes in RNA species at steady state but obscures the intracellular dynamics of RNA transcription, processing and decay. We developed thiol(SH)-linked alkylation for the metabolic sequencing of RNA (SLAM seq)
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico