Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

HPA036070

Sigma-Aldrich

Anti-PTK6 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-BRK, Anti-PTK6 protein tyrosine kinase 6

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

recombinant expression
Learn more about Antibody Enhanced Validation

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

secuencia del inmunógeno

PYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PTK6(5753)

Categorías relacionadas

Descripción general

PTK6 (protein tyrosine kinase 6) belongs to intracellular tyrosine kinases family. It is normally expressed in epithelial cells of skin, gastrointestinal tract and prostate. It is also called as breast tumor kinase (brk), for its critical role in progression of breast cancer. The PTK6 gene is located on the human chromosome 20q13.33. PTK6 protein is expressed in two isoforms.

Inmunógeno

PTK6 protein tyrosine kinase 6 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-PTK6 rabbit polyclonal antibody has been used in microarray analysis of PTK6 in breast tumor samples. It may also be used to detect protein tyrosine kinase 6 using western blot analysis in esophageal squamous cell carcinoma.

Acciones bioquímicas o fisiológicas

Protein tyrosine kinase 6 regulates epithelial cell gene expression by modulating RNA binding proteins. It favours epidermal growth factor receptor signalling cascade. Mutations in kinase domain leads to activity suppression. PTK6 is effectively inhibited by tumor suppressor protein phosphatase and tensin homolog (PTEN) in human prostate cancer tissues and cell lines. PTK6 is highly expressed and up-regulated in a multitude of human carcinomas including hepatocellular carcinoma, cervical squamous carcinoma, prostate cancer and colon cancer. PTK6 mediates proteasome-mediated degradation of tumor suppressor protein by phosphorylation. With the advent of its association in human cancer, PTK6 is considered as a potential drug target for cancer chemotherapy.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST78020

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

PTK6 inhibits downregulation of EGF receptor through phosphorylation of ARAP1
Kang SA, et al.
The Journal of Biological Chemistry, 279(52), jbc-M109 (2010)
PTEN is a protein phosphatase that targets active PTK6 and inhibits PTK6 oncogenic signaling in prostate cancer
Wozniak DJ, et al.
Nature Communications, 8(1), 1508-1508 (2017)
The alternative splice variant of protein tyrosine kinase 6 negatively regulates growth and enhances PTK6-mediated inhibition of $\beta$-catenin
Brauer PM, et al.
PLoS ONE, 6(3), e14789-e14789 (2011)
Targeting protein tyrosine kinase 6 enhances apoptosis of colon cancer cells following DNA damage
Gierut JJ, et al.
Molecular Cancer Therapeutics, 11(11), 2311-2320 (2012)
Assignment of the human PTK6 gene encoding a non-receptor protein tyrosine kinase to 20q13. 3 by fluorescence in situ hybridization
Park SH, et al.
Cytogenetic and genome research, 77(3-4), 271-272 (1997)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico