Saltar al contenido
Merck
Todas las fotos(5)

Documentos clave

HPA027598

Sigma-Aldrich

Anti-IL1R2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab2

Sinónimos:

Anti-CD121b, Anti-IL1RB, Anti-interleukin 1 receptor, type II

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

recombinant expression
Learn more about Antibody Enhanced Validation

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

secuencia del inmunógeno

GALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDK

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... IL1R2(7850)

Descripción general

Interleukin 1 receptor type 2 (IL1R2) comprises three immunoglobulin-like extracellular domains and a single helical transmembrane domain but lacks an intracellular Toll/interleukin-1 receptor (TIR) domain. It is a glycoprotein that exists in membrane-bound and soluble forms. IL1R2 is associated with macrophages, B-cells, and neutrophils. The IL1R2 gene is mapped to human chromosome 2q11.2.

Inmunógeno

interleukin 1 receptor, type II recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-IL1R2 antibody produced in rabbit has been used in immunohistochemistry.

Acciones bioquímicas o fisiológicas

Interleukin 1 receptor type 2 (IL1R2) is a decoy receptor that lacks signaling functionality. IL1R2 may serve as a target to treat IL-1-mediated inflammatory diseases. It is implicated in the pathophysiology of various disease states including autoimmune inner ear disease (AIED), Alzheime′s disease, and ulcerative colitis. Polymorphisms in IL1R2, as well as IL1R1, are implicated in high?altitude pulmonary edema (HAPE). Elevated levels of the soluble isoform of IL1R2 are reported in sepsis and rheumatoid arthritis disease states. It acts as a negative regulator of collagen-induced arthritis (CIA). Oxygen radicals exposure effectively triggers IL1R2 expression levels.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST78072

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

M Maruschke et al.
Urologia internationalis, 87(2), 205-217 (2011-07-16)
The initial objective of this renal cancer study was to identify gene sets in clear cell renal cell carcinoma (ccRCC) to support grading of ccRCC histopathology. Preselected ccRCC tumor tissues of grade 1 (G1, n = 14) and grade 3
Vanessa A Peters et al.
Brain, behavior, and immunity, 32, 1-8 (2012-12-01)
The cytokine IL-1 is critical to the pathogenesis of a variety of human conditions and diseases. Unlike most other cytokines, IL-1 is counterbalanced by two endogenous inhibitors. The functional significance of IL-1 receptor antagonist (IL-1RA) is well documented due to
Tianbo Jin et al.
Molecular genetics & genomic medicine, 7(3), e542-e542 (2019-01-24)
High-altitude pulmonary edema (HAPE), as a multifactorial disease, is caused by stress failure and involves both environmental and genetic factors. Study shows that IL-1 receptors can selectively decrease the oxygen arterial hypertension and influence the blood coagulation. So we evaluated
Kenji Shimizu et al.
Journal of immunology (Baltimore, Md. : 1950), 194(7), 3156-3168 (2015-03-01)
IL-1α and IL-1β (in this article referred to as IL-1) play important roles in host defense against infection and inflammatory diseases. IL-1R1 is the receptor for IL-1, and IL-1R2 is suggested to be a decoy receptor, because it lacks the
Praxedis Martin et al.
Journal of leukocyte biology, 94(4), 791-802 (2013-07-03)
The proinflammatory activities of IL-1 are tightly controlled at different levels. IL-1R2 acts as a decoy receptor and has been shown to regulate the biological effects of IL-1 in vitro and in vivo. However, little is known about its natural

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico