Saltar al contenido
Merck
Todas las fotos(7)

Documentos clave

HPA018458

Sigma-Aldrich

Anti-XIRP1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Sinónimos:

Anti-Cardiomyopathy-associated protein 1, Anti-Xin actin-binding repeat-containing protein 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnicas

immunohistochemistry: 1:200-1:500

secuencia del inmunógeno

RVSTEVAQLKEQTLARLLDIEEAVHKALSSMSSLQPEASARGHFQGPPKDHSAHKISVTVSSSARPSGSGQEVGGQTAVKNQAKVECHTEAQSQVKIRNHT

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... XIRP1(165904)

Descripción general

The gene XIRP1 (xin actin-binding repeat-containing protein-1) is mapped to human chromosome 3p22.2. It belongs to XIRP family. The protein is expressed during early developmental stages of cardiac and skeletal muscles. In adults, XIRP1 is mainly present in the intercalated discs of cardiomyocytes and the myotendinous junctions of skeletal muscle cells. The protein contains unique 16 amino acid repeats. Fluorescent tagging of the protein showed targeting to F-actin containing structures.

Inmunógeno

Xin actin-binding repeat-containing protein 1 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

Down-regulation of xin actin-binding repeat-containing protein-1 (XIRP1) in cultured chicken embryos results in abnormal development of the heart. XIRP1 is up-regulated in injured mouse muscle. The unique amino acid repeats in XIRP1 are responsible for binding and stabilization of actin-based cytoskeleton. XIRP1 interacts with phosphoglucomutase-like protein 5 (PGM5) and filamin C. All three together are present at intercalated discs of cardiac muscle and myotendinous junctions of skeletal muscle. XIRP1 also associates with the EVH1 (Ena/Vasp homology) domain proteins MENA (Protein enabled homolog) and VASP (Vasodilator-stimulated phosphoprotein). In adult heart, XIRP1 and MENA/VASP localizes with filamin C in intercalated discs.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST74653

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Sibylle Molt et al.
Journal of cell science, 127(Pt 16), 3578-3592 (2014-06-26)
Filamin C (FLNc) and Xin actin-binding repeat-containing proteins (XIRPs) are multi-adaptor proteins that are mainly expressed in cardiac and skeletal muscles and which play important roles in the assembly and repair of myofibrils and their attachment to the membrane. We
Beate St Pourcain et al.
Molecular autism, 5(1), 18-18 (2014-02-26)
Social-communication abilities are heritable traits, and their impairments overlap with the autism continuum. To characterise the genetic architecture of social-communication difficulties developmentally and identify genetic links with the autistic dimension, we conducted a genome-wide screen of social-communication problems at multiple
Dirk Pacholsky et al.
Journal of cell science, 117(Pt 22), 5257-5268 (2004-09-30)
Xin is a protein that is expressed during early developmental stages of cardiac and skeletal muscles. Immunolocalization studies indicated a peripheral localization in embryonic mouse heart, where Xin localizes with beta-catenin and N-cadherin. In adult tissues, Xin is found primarily
Peter F M van der Ven et al.
Experimental cell research, 312(11), 2154-2167 (2006-04-25)
Filamin c is the predominantly expressed filamin isoform in striated muscles. It is localized in myofibrillar Z-discs, where it binds FATZ and myotilin, and in myotendinous junctions and intercalated discs. Here, we identify Xin, the protein encoded by the human
Mats I Nilsson et al.
The American journal of pathology, 183(6), 1703-1709 (2013-11-15)
Xin is a striated muscle-specific protein that is localized to the myotendinous junction in skeletal muscle. However, in injured mouse muscle, Xin expression is up-regulated and observed throughout skeletal muscle fibers and within satellite cells. In this study, Xin was

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico