Saltar al contenido
Merck
Todas las fotos(4)

Documentos clave

HPA018132

Sigma-Aldrich

Anti-ZNHIT6 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Serologically defined breast cancer antigen NY-BR-75, Anti-Zinc finger HIT domain-containing protein 6

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.43

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

recombinant expression
Learn more about Antibody Enhanced Validation

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

secuencia del inmunógeno

KEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLL

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ZNHIT6(54680)

Categorías relacionadas

Descripción general

The gene has been mapped to human chromosome 1p22.3. Zinc finger HIT domain-containing protein-6 (ZNHIT6) encodes for a zinc finger protein, zinc finger HIT domain-containing protein-6.

Inmunógeno

Zinc finger HIT domain-containing protein 6 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

Zinc finger HIT domain-containing protein-6 (ZNHIT6) is an assembly factor which participates in the complex required for small nucleolar RNA (snoRNA) accumulation, processing and nucleolar localization. The protein associates with U3 and U8 pre-snoRNA. RNAi-mediated depletion of ZNHIT6 results in a significant reduction of U3, U8 and U14 snoRNA levels in HeLa cells. Pull down assay showed ZNHIT6 interaction with nucleolar protein 58 (NOP58), nuclear FMRP-interacting protein 1 (NUFIP), transcription initiation factor TFIID subunit-9 (TAF9), TATA box-binding protein-interacting protein (TIP48, TIP49 - interaction regulated by binding and hydrolysis of ATP) and fibrillarin. Additionally, co-immunoprecipitation and yeast two hybrid revealed ZNHIT6 interaction with zinc finger HIT domain-containing protein-3 (ZNHIT3). Double homeobox protein-4 (DUX4), a transcription factor, which is a leading candidate of facioscapulohumeral dystrophy (FSHD) induces the expression of ZNHIT6.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST73695

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Michael E Talkowski et al.
Cell, 149(3), 525-537 (2012-04-24)
Balanced chromosomal abnormalities (BCAs) represent a relatively untapped reservoir of single-gene disruptions in neurodevelopmental disorders (NDDs). We sequenced BCAs in patients with autism or related NDDs, revealing disruption of 33 loci in four general categories: (1) genes previously associated with
A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly.
McKeegan KS
Molecular and Cellular Biology, 27, 6782-6793 (2007)
Jonathan Bizarro et al.
The Journal of cell biology, 207(4), 463-480 (2014-11-19)
In vitro, assembly of box C/D small nucleolar ribonucleoproteins (snoRNPs) involves the sequential recruitment of core proteins to snoRNAs. In vivo, however, assembly factors are required (NUFIP, BCD1, and the HSP90-R2TP complex), and it is unknown whether a similar sequential
Linda N Geng et al.
Developmental cell, 22(1), 38-51 (2012-01-03)
Facioscapulohumeral dystrophy (FSHD) is one of the most common inherited muscular dystrophies. The causative gene remains controversial and the mechanism of pathophysiology unknown. Here we identify genes associated with germline and early stem cell development as targets of the DUX4

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico