Saltar al contenido
Merck
Todas las fotos(1)

Documentos

HPA014785

Sigma-Aldrich

Anti-TRPM1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-CSNB1C, Anti-LTRPC1, Anti-MLSN1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

VGGVNQDVEYSSITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEHKEQFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPDQTLGFPSLRSKSLHGHPRNVKSIQGKL

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... TRPM1(4308)

General description

TRPM1 (transient receptor potential cation channel, subfamily M, member 1) belongs to the subfamily of ion channels called TRPM. It was the first member of this family to be identified, and it was recognized as a melanoma metastasis suppressor. It is expressed by melanocytes of skin and eye. This ion channel is also coupled with mGluR6 (metabotropic glutamate receptor 6), and co-localizes with it at the dendrites of ON-bipolar cells. This gene is localized to human chromosome 15q13.3.

Immunogen

Transient receptor potential cation channel subfamily M member 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-TRPM1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Biochem/physiol Actions

TRPM1 (transient receptor potential cation channel, subfamily M, member 1) is responsible for the control of Ca2+ homeostasis during melanogenesis, which is also influenced by ultraviolet B. Its expression and the intracellular Ca2+ levels are significantly lower in rapidly dividing melanocytes, as opposed to differentiated melanocytes. It is also under-expressed in melanomas with metastatic potential. TRPM1 mRNA expression can be helpful in differentiating Spitz nevi and nodular melanomas. It is essential for synaptic communication between photoreceptors and ON-bipolar cells. In patients with Melanoma-associated retinopathy (MAR), the auto-antibodies are shown to bind with TRPM1 in bipolar cells, and might be responsible for non-responsiveness of cells to light. This gene is also linked with autosomal recessive congenital stationary night blindness.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73285.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Storage Class

12 - Non Combustible Liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Anuradha Dhingra et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 31(11), 3962-3967 (2011-03-18)
Melanoma-associated retinopathy (MAR) is characterized by night blindness, photopsias, and a selective reduction of the electroretinogram b-wave. In certain cases, the serum contains autoantibodies that react with ON bipolar cells, but the target of these autoantibodies has not been identified.
Alice Masurel-Paulet et al.
American journal of medical genetics. Part A, 164A(6), 1537-1544 (2014-03-29)
The 15q13.3 heterozygous microdeletion is a fairly common microdeletion syndrome with marked clinical variability and incomplete penetrance. The average size of the deletion, which comprises six genes including CHRNA7, is 1.5 Mb. CHRNA7 has been identified as the gene responsible
Jacqueline Gayet-Primo et al.
Frontiers in cellular neuroscience, 9, 486-486 (2016-01-07)
Photoreceptor degeneration differentially impacts glutamatergic signaling in downstream On and Off bipolar cells. In rodent models, photoreceptor degeneration leads to loss of glutamatergic signaling in On bipolar cells, whereas Off bipolar cells appear to retain glutamate sensitivity, even after extensive
Wei-Hong Xiong et al.
PloS one, 8(8), e69506-e69506 (2013-08-13)
Melanoma-associated retinopathy (MAR) is a paraneoplastic syndrome associated with cutaneous malignant melanoma and the presence of autoantibodies that label neurons in the inner retina. The visual symptoms and electroretinogram (ERG) phenotype characteristic of MAR resemble the congenital visual disease caused
Jared C Gilliam et al.
Vision research, 51(23-24), 2440-2452 (2011-11-01)
In order to identify candidate cation channels important for retinal physiology, 28 TRP channel genes were surveyed for expression in the mouse retina. Transcripts for all TRP channels were detected by RT-PCR and sequencing. Northern blotting revealed that mRNAs for

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico