Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV54274

Sigma-Aldrich

Anti-ATG10 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-APG10, Anti-APG10L, Anti-ATG10 autophagy related 10 homolog (S. cerevisiae), Anti-DKFZP586I0418, Anti-FLJ13954, Anti-Pp12616

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

25 kDa

reactividad de especies

mouse, rat, human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ATG10(83734)

Descripción general

ATG10 [autophagy related 10 homolog (S. cerevisiae)] or APG10 gene encodes a protein necessary for autophagy in yeast. Autophagy is a catabolic cellular event that includes cell death of superfluous or dysfunctional cellular components, cell differentiation and aging. It is also crucial for the maintenance of amino acid levels and protein synthesis under nitrogen starvation and is enhanced under certain conditions such as hormonal stimulation and drug treatments.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human ATG10

Aplicación

Anti-ATG10 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Acciones bioquímicas o fisiológicas

Atg10 is an E2-like enzyme that facilitates the addition of ubiquitination modifications essential for autophagosome formation. It catalyzes the conjugation of ATG12 to ATG5, which is essential for proper localization of ATG8 to the preautophagosomal structure (PAS). Further, Atg10 also plays a role in modifying the soluble form of LC3 to the membrane-bound form during Atg12 conjugation.

Secuencia

Synthetic peptide located within the following region: TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

[The nurse; cancerology and radiotherapy].
C Chenal et al.
Revue de l'infirmiere, 26(8), 686-695 (1976-10-01)
Miao-Qing Zhang et al.
Frontiers in immunology, 9, 2176-2176 (2018-10-16)
Autophagy-related 10 (ATG10) is essential for autophagy since it promotes ATG5-ATG12 complex formation. Our previous study found that there are two isoforms of the ATG10 protein, ATG10 (a longer one) and ATG10S, which have identical sequences except an absence of
N Mizushima et al.
Nature, 395(6700), 395-398 (1998-10-06)
Autophagy is a process for the bulk degradation of proteins, in which cytoplasmic components of the cell are enclosed by double-membrane structures known as autophagosomes for delivery to lysosomes or vacuoles for degradation. This process is crucial for survival during
Takahiro Nemoto et al.
The Journal of biological chemistry, 278(41), 39517-39526 (2003-08-02)
Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes/vacuoles. The formation of autophagosomes involves a dynamic rearrangement of the membrane for which two ubiquitin-like modifications (the conjugation of Apg12p and the modification of a soluble form

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico