Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV50815

Sigma-Aldrich

Anti-VGLL2 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-VGL2, Anti-VITO1, Anti-Vestigial like 2 (Drosophila)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

33 kDa

reactividad de especies

horse, rat, rabbit, dog, human, bovine, guinea pig

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... VGLL2(245806)

Categorías relacionadas

Inmunógeno

Synthetic peptide directed towards the middle region of human VGLL2

Aplicación

Anti-VGLL2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Acciones bioquímicas o fisiológicas

Vestigial-like family member 2 (VGLL2) acts as a co-factor of transcriptional enhancer factor 1 (TEF-1) and regulates transcription during skeletal muscle development. Members of VGLL family are involved in embryonic patterning, determination of cell fate, neural crest cell survival and craniofacial development in zebrafish.

Secuencia

Synthetic peptide located within the following region: RPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKAP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Corinne Faucheux et al.
The International journal of developmental biology, 54(8-9), 1375-1382 (2010-08-17)
The Drosophila Vestigial and Scalloped proteins form heterodimers that control wing development and are involved in muscle differentiation. Four vestigial like genes have been described in mammals. Similar to the Drosophila vestigial gene, they encode a short conserved domain (TONDU)
Christopher W Johnson et al.
Developmental biology, 357(1), 269-281 (2011-07-12)
Invertebrate and vertebrate vestigial (vg) and vestigial-like (VGLL) genes are involved in embryonic patterning and cell fate determination. These genes encode cofactors that interact with members of the Scalloped/TEAD family of transcription factors and modulate their activity. We have previously

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico