AV46802

Anti-SILV antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-D12S53E, Anti-Gp100, Anti-ME20, Anti-PMEL17, Anti-SI, Anti-SIL, Anti-Silver homolog (mouse)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 70 kDa
• reactividad de especies: mouse, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_008859
• Nº de acceso UniProt: P40967
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SILV(6490)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human SILV

Aplicación

Anti-SILV antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Acciones bioquímicas o fisiológicas

SILV [Silver homolog (mouse)] gene encodes a melanocyte-specific type I transmembrane glycoprotein expressed primarily in melanocytes and at low levels in normal cell lines and tissues. It facilitates in the structural organization of premelanosomes within multivesicular bodies. The encoded protein is also involved in generating internal matrix fibers that define the transition from stage I to stage II melanosomes.

Secuencia

Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable