Synthetic peptide directed towards the N terminal region of human NOVA2
Acciones bioquímicas o fisiológicas
NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.
Secuencia
Synthetic peptide located within the following region: MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Cancer management and research, 12, 12779-12790 (2020-12-29)
Circular RNAs (circRNAs) have increasingly been investigated in different cancers due to their regulatory roles. In this study, hsa_circ_0046263 will be detailedly researched in non-small cell lung cancer (NSCLC). The analyses of hsa_circ_0046263, microRNA-940 (miR-940), and neuro-oncological ventral antigen 2
Questions
Reviews
★★★★★ No rating value
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
