AV32639

Anti-HOXB9 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-HGNC:5120, Anti-HOX-2.5, Anti-HOX2, Anti-HOX2E, Anti-Homeobox protein Hox-B9
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 28 kDa
• reactividad de especies: rabbit, bovine, horse, pig, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_076922
• Nº de acceso UniProt: P17482
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... HOXB9(3219)

Descripción

Descripción general

HOXB9 is a homeobox transcription factor that regulates cell growth and differentiation. HOXB9 is expressed throughout early bovine embryogenesis and has been implicated in thyroid cancer.
Rabbit Anti-HOXB9 antibody recognizes human, mouse, rat, bovine, and canine HOXB9.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human HOXB9

Aplicación

Rabbit Anti-HOXB9 antibody has been used to detect Hoxb9 in bovine in embryos using whole-mount immunofluorescence and western blot techniques. The antibody has also been used at a dilution of 1:50 for immunohistochemical analysis in papillary thyroid carcinomas.

Acciones bioquímicas o fisiológicas

HOXB9 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. HOXB9 is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.

Secuencia

Synthetic peptide located within the following region: SPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable