Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV32066

Sigma-Aldrich

Anti-IRX4 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Iroquois homeobox protein 4, Anti-MGC131996

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

54 kDa

reactividad de especies

pig, bovine, human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_057442

Nº de acceso UniProt

P78413

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... IRX4(50805)

Descripción general

IRX4 gene variations have been implicated in congenital heart disease and prostate cancer susceptibility. Rabbit Anti-IRX4 antibody recognizes bovine, human, mouse, and rat IRX4.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human IRX4

Aplicación

Rabbit Anti-IRX4 antibody can be used for western blot applications at a concentration of 2.5μg/ml.

Acciones bioquímicas o fisiológicas

IRX4 is likely to be an important mediator of ventricular differentiation during cardiac development.

Secuencia

Synthetic peptide located within the following region: SAAALGVYGGPYGGSQGYGNYVTYGSEASAFYSLNSFDSKDGSGSAHGGL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC11850

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Hai Ha Nguyen et al.
Human molecular genetics, 21(9), 2076-2085 (2012-02-11)
Recent genome-wide association studies (GWAS) identified a number of prostate cancer (PC) susceptibility loci, but most of their functional significances are not elucidated. Through our previous GWAS for PC in a Japanese population and subsequent resequencing and fine mapping, we
Zhi Cheng et al.
Human genetics, 130(5), 657-662 (2011-05-06)
IRX4 was the first identified cardiac transcription factor that is restricted to the ventricles at all stages of heart development. Irx4-deficient mice show ventricular dysfunction and develop cardiomyopathy. To study the potential impact of sequence variations in IRX4 on congenital
Takao Kitagawa et al.
PloS one, 17(10), e0269077-e0269077 (2022-10-05)
Ewing's sarcoma is the second most common bone malignancy in children or young adults and is caused by an oncogenic transcription factor by a chromosomal translocation between the EWSR1 gene and the ETS transcription factor family. However, the transcriptional mechanism

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico