Saltar al contenido
Merck
Todas las fotos(4)

Documentos clave

AV31874

Sigma-Aldrich

Anti-ZBTB32 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Zinc finger and BTB domain containing 32

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

33 kDa

reactividad de especies

rat, human, bovine, guinea pig, rabbit

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ZBTB32(27033)

Descripción general

ZBTB32 is a zinc-finger protein that can repress the expression of CIITA and MHC II genes during B cell differentiation.
Rabbit Anti-ZBTB32 recognizes bovine, mouse, canine, and human ZBTB32.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ZBTB32

Aplicación

Rabbit Anti-ZBTB32 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Acciones bioquímicas o fisiológicas

ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.

Secuencia

Synthetic peptide located within the following region: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Hye Suk Yoon et al.
Journal of immunology (Baltimore, Md. : 1950), 189(5), 2393-2403 (2012-08-02)
CIITA and MHC class II expression is silenced during the differentiation of B cells to plasma cells. When B cell differentiation is carried out ex vivo, CIITA silencing occurs rapidly, but the factors contributing to this event are not known.

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico