AV31708

Anti-ZNF609 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Zinc finger protein 609
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 155 kDa
• reactividad de especies: rat, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_055857
• Nº de acceso UniProt: O15014
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ZNF609(23060)

Descripción

Descripción general

ZNF609 is a zinc-finger protein that may function as a p53-regulated target.
Rabbit Anti-ZNF609 antibody recognizes chicken, human, bovine, mouse, and rat ZNF609.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ZNF609

Aplicación

Rabbit Anti-ZNF609 antibody can be used for western blot applications at a concentration of 1.25μg/ml.

Acciones bioquímicas o fisiológicas

The function of ZNF609 remains unknown.

Secuencia

Synthetic peptide located within the following region: NIKFVTPVPGPQGKEGKSKSKRSKSGKDTSKPTPGTSLFTPSEGAASKKE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable