POU6F1 is a POU homeobox containing transcription factor that represses Oct2A-mediated stimulation. POU6F1 has been implicated in cell proliferation and ovarian adenocarcinoma. Rabbit Anti-POU6F1 (AB1) recognizes human, mouse, rat, canine, zebrafish, and bovine POU6F1
Immunogen
Synthetic peptide directed towards the middle region of human POU6F1
Application
Rabbit Anti-POU6F1 (AB1) antibody can be used for immunohistochemistry (4-8μg/ml) and western blot (0.12μg/ml) applications.
Biochem/physiol Actions
The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression.
Sequence
Synthetic peptide located within the following region: YFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Biochemical and biophysical research communications, 220(2), 274-279 (1996-03-18)
Transcription factors of the POU family recognize DNA through their POU domain which represents a bipartite DNA binding motif consisting of a POU specific domain and a POU homeobox. It is thought that both subdomains make specific contacts with DNA
Clear cell adenocarcinoma of the ovary often shows resistance to anticancer agents. We investigated new molecules to use when developing molecular-targeting therapy for clear cell adenocarcinoma of the ovary. RMG-I cells without invasive potential and RMG-V cells with invasive potential
Questions
Reviews
★★★★★ No rating value
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.