Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV13056

Sigma-Aldrich

Anti-RAB3A antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-RAB3A, member RAS oncogene family

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

25 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... RAB3A(5864)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human RAB3A

Aplicación

Anti- RAB3D antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Acciones bioquímicas o fisiológicas

Rab3A is a synaptic vesicle-associated GTPase that regulates Ca+2-dependent exocytosis. It is ubiquitously present in nervous system and in the acrosomal region of human sperm. Rab3A forms complex with RIM and Munc13 proteins to regulate synaptic vesicles docking and acrosomal exocytosis. It is a regulator of Ca+2-dependent release of α-melanocyte stimulating hormone.

Secuencia

Synthetic peptide located within the following region: NVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Simon Sedej et al.
PloS one, 8(10), e78883-e78883 (2013-11-10)
Rab3a is a small GTPase of the Rab3 subfamily that acts during late stages of Ca²⁺-regulated exocytosis. Previous functional analysis in pituitary melanotrophs described Rab3a as a positive regulator of Ca²⁺-dependent exocytosis. However, the precise role of the Rab3a isoform
Oscar D Bello et al.
Experimental cell research, 318(5), 478-488 (2012-01-18)
Exocytosis is a highly regulated, multistage process consisting of multiple functionally definable stages, including recruitment, targeting, tethering, priming, and docking of secretory vesicles with the plasma membrane, followed by calcium-triggered membrane fusion. The acrosome reaction of spermatozoa is a complex
Miao Tian et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 32(20), 6931-6936 (2012-05-18)
Rab3A is a synaptic vesicle-associated protein found throughout the nervous system, but its precise function is unknown. Genetic knock-out studies show that Rab3A is not necessary for vesicular release or replenishment at conventional synapses in the brain. Here we explore

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico