APREST94828

PrEST Antigen ANKRD55

Prestige Antibodies^® Powered by Atlas Antibodies, buffered aqueous solution

• Sinónimos: FLJ11795
• UNSPSC Code: 12352203

Propiedades

• recombinant: expressed in E. coli
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• assay: >80% (SDS-PAGE)
• form: buffered aqueous solution
• mol wt: predicted mol wt 27 kDa
• purified by: immobilized metal affinity chromatography (IMAC)
• concentration: ≥0.5 mg/mL
• sequence note: RQATMDFSTPSVFDQQRGDSSEEVDLTMVYQAASNGDVNALTAVIREDPSILECCDSEGCTPLMHAVSGRQADTVKLLLKMGAN
• Ensembl | human accession no.: ENSG00000164512
• UniProt accession no.: Q3KP44
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... ANKRD55(79722)

Descripción

General description

N-terminal His₆ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Application

Suitable as a blocking agent and positive assay control using corresponding antibodies.

Linkage

Corresponding Antibodies HPA061649

Physical form

Solution in 1 M urea-PBS, pH 7.4

Storage and Stability

Store at -20°C. Avoid repeated freeze/thaw cycles.

Other Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable