Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

APREST94121

Sigma-Aldrich

PrEST Antigen IRS1

Prestige Antigens Powered by Atlas Antibodies

Sinónimos:

HIRS-1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203

recombinante

expressed in E. coli

Ensayo

>80% (SDS-PAGE)

Formulario

buffered aqueous solution

mol peso

predicted mol wt 25 kDa

purificado por

immobilized metal affinity chromatography (IMAC)

concentración

≥0.5 mg/mL

secuencia del inmunógeno

RKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPL

Ensembl | nº de acceso humano

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... IRS1(3667)

Descripción general

Recombinant protein fragment of Human IRS1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag

Aplicación

Blocking agent and positive assay control using corresponding antibodies.

Forma física

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Nota de preparación

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documentos section.

Si necesita más asistencia, póngase en contacto con Atención al cliente

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico