Documentos clave

Ver Toda la documentación

Saltar a

613571

TIRAP Inhibitor Peptide, Control, Cell-Permeable

Name: TIRAP Inhibitor Peptide, Control, Cell-Permeable
Brand: MM

The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.

Sinónimos:

TIRAP Inhibitor Peptide, Control, Cell-Permeable, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, Ant-Tirap _151-138, TIRAP Peptide, Control, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL), Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, Ant-Tirap_151-138, TIRAP Peptide, Control, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño

Cambiar Vistas

Talla/SKU	Disponibilidad	Precio

Acerca de este artículo

Fórmula empírica (notación de Hill):

C₁₆₃H₂₆₈N₅₂O₃₈S

Peso molecular:

3596.26

NACRES:

NA.77

UNSPSC Code:

12352202

Assay:

≥97% (HPLC)

Form:

lyophilized solid

Storage condition:

OK to freeze, desiccated (hygroscopic), protect from light

En este momento no podemos mostrarle ni los precios ni la disponibilidad

Servicio técnico

¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.

Permítanos ayudarle

Propiedades

Quality Segment

100

assay

≥97% (HPLC)

form

lyophilized solid

manufacturer/tradename

Calbiochem^®

storage condition

OK to freeze, desiccated (hygroscopic), protect from light

color

white

solubility

DMSO: 5 mg/mL

shipped in

wet ice

storage temp.

−20°C

Descripción

General description

A cell-permeable synthetic peptide containing mouse TIRAP_151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).

Biochem/physiol Actions

Cell permeable: yes

Primary Target
Control for TIRAP inhibitor

Product does not compete with ATP.

Reversible: no

Packaging

Packaged under inert gas

Physical form

Supplied as a trifluoroacetate salt.

Preparation Note

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Other Notes

H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH

Horng, T., et al. 2001. Nat. Immunol.2, 835.

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Toxicity: Standard Handling (A)

Comparar elementos similares

Ver comparación completa

Mostrar Diferencias

1 of 1

Este artículo	573096	208735	189485
Sigma-Aldrich 613571 TIRAP Inhibitor Peptide, Control, Cell-Permeable	Sigma-Aldrich 573096 STAT3 Inhibitor Peptide, Cell-Permeable	Sigma-Aldrich 208735 Calmodulin Inhibitory Peptide	Sigma-Aldrich 189485 Autocamtide-2 Related Inhibitory Peptide II, Cell-permeable
description The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.	description The STAT3 Inhibitor Peptide, Cell-Permeable controls the biological activity of STAT3.	description The Calmodulin Inhibitory Peptide controls the biological activity of Calmodulin. This small molecule/inhibitor is primarily used for Cell Signaling applications.	description The Autocamtide-2 Related Inhibitory Peptide II, Cell-permeable controls the biological activity of calmodulin-dependent protein kinase II. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
assay ≥97% (HPLC)	assay ≥95% (HPLC)	assay ≥95% (HPLC)	assay ≥97% (HPLC)
form lyophilized solid	form lyophilized solid	form lyophilized	form lyophilized solid
manufacturer/tradename Calbiochem^®	manufacturer/tradename Calbiochem^®	manufacturer/tradename Calbiochem^®	manufacturer/tradename Calbiochem^®
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 200
storage temp. −20°C	storage temp. −20°C	storage temp. −20°C	storage temp. −20°C
storage condition OK to freeze, protect from light, desiccated (hygroscopic)	storage condition desiccated (hygroscopic), OK to freeze	storage condition OK to freeze, desiccated (hygroscopic)	storage condition desiccated (hygroscopic), OK to freeze, protect from light

Clase de almacenamiento

11 - Combustible Solids

¿Qué está pasando?

WGK 1

Punto de inflamación (°F)

Not applicable

Punto de inflamación (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documentos section.

Si necesita más asistencia, póngase en contacto con Atención al cliente

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.