Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

374087

Sigma-Aldrich

Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

liquid, clone HO-1-1, Calbiochem®

Sinónimos:

Anti-HO-1, Anti-Hsp32

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

forma del anticuerpo

purified antibody

tipo de anticuerpo

primary antibodies

clon

HO-1-1, monoclonal

Formulario

liquid

contiene

≤0.1% sodium azide as preservative

reactividad de especies

human, rat, canine, monkey, mouse, bovine

fabricante / nombre comercial

Calbiochem®

condiciones de almacenamiento

OK to freeze
avoid repeated freeze/thaw cycles

isotipo

IgG1

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

bovine ... Hmox1(513221)
dog ... Hmox1(442987)
human ... HMOX1(3162)
mouse ... Hmox1(15368)
rat ... Hmox1(24451)
rhesus monkey ... Hmox1(719266)

Descripción general

Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.
Protein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.
Recognizes the ~32 kDa HO-1 protein.

Inmunógeno

Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

Aplicación

Immunoblotting (4 µg/ml, chemiluminescence)

Immunocytochemistry (1:1000)

Immunoprecipitation (20 µg/ml)

Envase

Please refer to vial label for lot-specific concentration.

Advertencia

Toxicity: Standard Handling (A)

Forma física

In PBS, 50% glycerol.

Reconstitución

Following initial thaw, aliquot and freeze (-20°C).

Otras notas

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J.2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

Información legal

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

László Potor et al.
Oxidative medicine and cellular longevity, 2018, 3812568-3812568 (2018-03-22)
The infiltration of red blood cells into atheromatous plaques is implicated in atherogenesis. Inside the lesion, hemoglobin (Hb) is oxidized to ferri- and ferrylHb which exhibit prooxidant and proinflammatory activities. Cystathione gamma-lyase- (CSE-) derived H2S has been suggested to possess
Hai Lu et al.
Brain sciences, 14(5) (2024-05-25)
The discovery of novel diagnostic methods and therapies for Alzheimer's disease (AD) faces significant challenges. Previous research has shed light on the neuroprotective properties of Apelin-13 in neurodegenerative disorders. However, elucidating the mechanism underlying its efficacy in combating AD-related nerve
László Potor et al.
Oxidative medicine and cellular longevity, 2013, 676425-676425 (2013-06-15)
Oxidized cell-free hemoglobin (Hb), including covalently cross-linked Hb multimers, is present in advanced atherosclerotic lesions. Oxidation of Hb produces methemoglobin (Fe(3+)) and ferryl hemoglobin (Fe(4+) = O(2-)). Ferryl iron is unstable and can return to the Fe(3+) state by reacting
Steven J T Jackson et al.
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association, 60, 431-438 (2013-08-14)
Curcumin, a component of turmeric spice that imparts flavor and color to curry, is thought to possess anti-inflammatory and antioxidant properties in biological tissues. However, while such efficacies have been described in the context of carcinogenesis, the impact of curcumin
Ye Tian et al.
PloS one, 18(1), e0279964-e0279964 (2023-01-07)
Sepsis associated encephalopathy (SAE) is a common but poorly understood complication during sepsis. Currently, there are no preventive or therapeutic agents available for this neurological disorder. The present study was designed to determine the potential protective effects of β-patchoulene (β-PAE)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico