SAB2103325

Anti-SLC25A32 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-FLJ23872, Anti-MFT, Anti-MFTC
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 35 kDa
• species reactivity: mouse, yeast, horse, guinea pig, human, rat, dog, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_030780
• UniProt accession no.: Q9H2D1
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SLC25A32(81034)

Description

Immunogen

Synthetic peptide directed towards the middle region of human SLC25A32

Biochem/physiol Actions

SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria (Titus and Moran, 2000 [PubMed 10978331]).[supplied by OMIM].

Sequence

Synthetic peptide located within the following region: NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable