MSST0044
SILu™Lite TIMP1, Metalloproteinase inhibitor 1 human
recombinant, expressed in HEK 293 cells, MS Protein Standard
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
23201100
NACRES:
NA.12
General description
SILu™Lite TIMP1 is a recombinant human protein expressed in human 293 cells. It consists of 184 amino acids, with a calculated molecular mass of 20.7 kDa. SILu™Lite TIMP1 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
TIMP-1 is glycoprotein that is over-expressed in the supernatant of tissue extracts of breast, gastric, colorectal, and hepatocellular carcinomas. It belongs to the family of “tissue inhibitors of metalloproteinases,” a group of proteins that help regulate bone turnover. TIMP-1 serum levels are significantly associated with HER2 extracellular domain (ECD)-positivity and poorer disease-free survival among primary breast cancer patients with HER2 overexpression. High levels of serum TIMP-1 correlate with advanced disease and predict for poor survival in patients with multiple myeloma treated with bortezomib and/or IMiDs during their disease course.
Sequence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class Code
11 - Combustible Solids
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service