Skip to Content
Merck
All Photos(1)

Key Documents

AV50121

Sigma-Aldrich

Anti-JAM3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Junctional adhesion molecule 3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

28 kDa

species reactivity

human, guinea pig, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... JAM3(83700)

General description

The gene Junctional adhesion molecule 3 (JAM3; JAM-C) is mapped to human chromosme 11q25. JAM3 is a type I transmembrane glycoprotein and contains Ig-like domains. It belongs to Ig-superfamily called as JAMs. JAM3 is widely expressed with predominant expression in placenta, brain and kidney. It is also expressed in platelets but not in other blood cells.

Immunogen

Synthetic peptide directed towards the N terminal region of human JAM3

Application

Anti-JAM3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Junctional adhesion molecule 3 (JAM3; JAM-C) is a protein localized at the tight junctions of endothelial cells and acts as a receptor for another JAM molecule. JAM3 is involved in the regulation of vascular permeability, angiogenesis and nerve function. Deficient expression of JAM3 results in severe hydrocephalus[1] and development of tumors in murine models. JAM3 is involved in lymphangiogenesis and nodal metastasis in non-small cell lung cancer.[2] It is also associated with melanoma cell metastasis.

Sequence

Synthetic peptide located within the following region: SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

David A Leinster et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 27(10), 4244-4253 (2013-07-05)
Junctional adhesion molecule C (JAM-C) is a transmembrane protein with significant roles in regulation of endothelial cell (EC) functions, including immune cell recruitment and angiogenesis. As these responses are important in promoting tumor growth, the role of EC JAM-C in
Harald F Langer et al.
Cancer research, 71(12), 4096-4105 (2011-05-20)
Hematogenous dissemination of melanoma is a life-threatening complication of this malignant tumor. Here, we identified junctional adhesion molecule-C (JAM-C) as a novel player in melanoma metastasis to the lung. JAM-C expression was identified in human and murine melanoma cell lines
Lena Wyss et al.
PloS one, 7(9), e45619-e45619 (2012-10-03)
The junctional adhesion molecule (JAM)-C is a widely expressed adhesion molecule regulating cell adhesion, cell polarity and inflammation. JAM-C expression and function in the central nervous system (CNS) has been poorly characterized to date. Here we show that JAM-C(-/-) mice
Sentot Santoso et al.
The Journal of experimental medicine, 196(5), 679-691 (2002-09-05)
The recently described junctional adhesion molecules (JAMs) in man and mice are involved in homotypic and heterotypic intercellular interactions. Here, a third member of this family, human JAM-3, was identified and described as a novel counterreceptor on platelets for the
M P Arrate et al.
The Journal of biological chemistry, 276(49), 45826-45832 (2001-10-09)
We have identified a third member of the junctional adhesion molecule (JAM) family. At the protein level JAM3 displays 36 and 32% identity to JAM2 and JAM1, respectively. The coding region is distributed over 9 exons and maps to chromosome

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service