HOXB9 is a homeobox transcription factor that regulates cell growth and differentiation. HOXB9 is expressed throughout early bovine embryogenesis and has been implicated in thyroid cancer. Rabbit Anti-HOXB9 antibody recognizes human, mouse, rat, bovine, and canine HOXB9.
Immunogen
Synthetic peptide directed towards the N terminal region of human HOXB9
Application
Rabbit Anti-HOXB9 antibody has been used to detect Hoxb9 in bovine in embryos using whole-mount immunofluorescence and western blot techniques. The antibody has also been used at a dilution of 1:50 for immunohistochemical analysis in papillary thyroid carcinomas.
Biochem/physiol Actions
HOXB9 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. HOXB9 is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.
Sequence
Synthetic peptide located within the following region: SPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Papillary thyroid carcinoma is the most common type of thyroid malignancy, and CD56, a neural cell adhesion molecule, is typically down-regulated in almost all cases of papillary thyroid carcinoma. Homeobox B9 is a transcription factor, belongs to the products of
We previously showed that the homeodomain transcription factor HOXB9 is expressed in mammalian oocytes and early embryos. However, a systematic and exhaustive study of the localization of the HOXB9 protein, and HOX proteins in general, during mammalian early embryonic development
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
