Skip to Content
Merck
All Photos(6)

Key Documents

HPA001204

Sigma-Aldrich

Anti-STX17 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-KAT01814 antibody produced in rabbit, Anti-Syntaxin-17 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... STX17(55014)

General description

Syntaxin 17 (Stx17) is an autophagosomal SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein. STX17 is a member of the syntaxin family and is located on human chromosome 9q31. It is stored in the cytosol.

Immunogen

Syntaxin-17 recombinant protein epitope signature tag (PrEST)

Application

Anti-STX17 antibody has been used:
  • in SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein reconstitution
  • in immunoelectron microscopy
  • to investigate its relevance to the hepatitis C virus (HCV) life cycle and, thereby, to reveal the role of autophagosome-lysosome fusion for the turnover of viral particles

Anti-STX17 antibody produced in rabbit is suitable for co-immunoprecipitation.
Anti-STX17 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Syntaxin 17 (STX17) is an autophagosomal SNARE (soluble N-ethylmaleimide–sensitive factor attachment protein receptors) that in involved in fusion with the endosome/lysosome. It is mostly localized to the ER and to some extent in the ER-Golgi intermediate compartment (ERGIC). It may function as a receptor at the ER membrane that is involved in the trafficking between the ER and post-ER compartments. It cycles between ER and ERGIC via pathways involving COPII and COPI (coatomer protein I) vesicle. The protein is required for the maintenance of ERGIC and Golgi architecture.
Syntaxin 17 (Stx17) encodes membrane proteins, that participates in synaptic vesicle fusion.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79900

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The autophagosomal SNARE protein syntaxin 17 is an essential factor for the hepatitis C virus life cycle
Ren H, et al.
Journal of virology, JVI-00551 (2016)
The autophagosomal SNARE protein syntaxin 17 is an essential factor for the hepatitis C virus life cycle
Ren H, et al.
Journal of Virology, 520(7548), JVI-00551 (2016)
Jennifer Jung et al.
Bio-protocol, 7(17), 27982478-27982478 (2017-10-03)
Autophagy is a recycling pathway, in which intracellular cargoes including protein aggregates and bacteria are engulfed by autophagosomes and subsequently degraded after fusion with lysosomes. Dysregulation of this process is involved in several human diseases such as cancer or neurodegeneration.
LAMP-2 is required for incorporating syntaxin-17 into autophagosomes and for their fusion with lysosomes
Hubert V, et al.
Biology Open, bio-018648 (2016)
Huimei Ren et al.
Journal of virology, 90(13), 5989-6000 (2016-04-22)
Syntaxin 17 is an autophagosomal SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein required for the fusion of autophagosomes with lysosomes to form autolysosomes and thereby to deliver the enclosed contents for degradation. Hepatitis C virus (HCV) induces autophagy. In

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service