Skip to Content
Merck
All Photos(2)

Key Documents

WH0114804M1

Sigma-Aldrich

Monoclonal Anti-RNF157 antibody produced in mouse

clone 6B3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ring finger protein 157

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

6B3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RNF157(114804)

General description

RNF157 (Ring finger protein 157) is a novel E3 ubiquitin ligase predominantly expressed in the brain. It has a molecular mass of 110kDa.

Immunogen

RNF157 (NP_443148, 556 a.a. ~ 655 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PASRAPSEEGEGLPAESPDSNFAGLPAGEQDAEGNDVIEEEDGSPTQEGQRTCAFLGMECDNNNDFDIASVKALDNKLCSEVCLPGAWQADDNAVSRNAQ

Biochem/physiol Actions

RNF157 (Ring finger protein 157) is highly involved in the regulation of neuronal development and morphology of the neurons. It promotes dendritic growth by interacting with adaptor protein Fe65. Its N-terminal end binds to the second PTB domain of Fe65 to ubiquitinate Fe65 via E3 ligase activity. It has also been reported that RNF157 may be involved in the regulation of membrane protein trafficking.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Tiantian Qi et al.
Investigative ophthalmology & visual science, 63(4), 11-11 (2022-04-19)
Age-related cataract (ARC) is a major cause of vision impairment worldwide. The E3 ubiquitin ligase RING finger protein 157 (RNF157) is involved in regulating cell survival and downregulated in human cataractous lens samples. However, the function of RNF157 in cataracts
Damian D Guerra et al.
FEBS letters, 587(21), 3400-3405 (2013-09-17)
Plant LOSS OF GDU 2 (LOG2) and Mammalian Mahogunin Ring Finger 1 (MGRN1) proteins are RING-type E3 ligases sharing similarity N-terminal to the RING domain. Deletion of this region disrupts the interaction of LOG2 with the plant membrane protein GLUTAMINE
A Matz et al.
Cell death and differentiation, 22(4), 626-642 (2014-10-25)
Neuronal health is essential for the long-term integrity of the brain. In this study, we characterized the novel E3 ubiquitin ligase ring finger protein 157 (RNF157), which displays a brain-dominant expression in mouse. RNF157 is a homolog of the E3
Han Guan et al.
Frontiers in oncology, 12, 1021270-1021270 (2022-10-21)
Exosomes have been identified to mediate the transmission of RNAs among different cells in tumor microenvironment, thus affecting the progression of different diseases. However, exosomal messenger RNAs (mRNAs) have been rarely explored. RNF157 mRNA has been found to be up-regulated

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service