Synthetic peptide directed towards the N terminal region of human NEK7
Application
Anti-NEK7antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
NIMA-related kinase 7 (NEK7), a serine/threonine protein kinase is required for the proper formation of spindle during mitosis. NEK7 recruits centrosomal pericentriolar material (PCM) proteins which are required for centriole duplication and spindle pole formation. Optimum activity of NEK7 is necessary for cell cycle progression during M and G1 phase and during cytokinesis.
Sequence
Synthetic peptide located within the following region: KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of cell science, 124(Pt 22), 3760-3770 (2011-11-22)
The centrosomes in dividing cells follow a series of cyclical events of duplication and separation, which are tightly linked to the cell cycle. Serine/threonine-protein kinase NEK7 (NEK7) is a centrosomal kinase that is required for proper spindle formation during mitosis.
Molecular and cellular biology, 29(14), 3975-3990 (2009-05-06)
Nek6 and Nek7 are members of the NIMA-related serine/threonine kinase family. Previous work showed that they contribute to mitotic progression downstream of another NIMA-related kinase, Nek9, although the roles of these different kinases remain to be defined. Here, we carried
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.