Skip to Content
Merck
All Photos(3)

Key Documents

AV38780

Sigma-Aldrich

Anti-SMC1A antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CDLS2, Anti-DKFZp686L19178, Anti-DXS423E, Anti-KIAA0178, Anti-MGC138332, Anti-SB1.8, Anti-SMC1, Anti-Structural maintenance of chromosomes 1A

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

143 kDa

species reactivity

human, rabbit, guinea pig, mouse, dog, rat, bovine, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SMC1A(8243)

Immunogen

Synthetic peptide directed towards the C terminal region of human SMC1A

Biochem/physiol Actions

Structural maintenance of chromosomes (SMC) proteins maintain the sister chromatid cohesion during the process of cell division. SMC1A is present in the kinetochore, interacts with BRCA1 and ATM proteins indicating a role in DNA repair. It is reportedly involved in the G2/M transition of human glioma cells and G1/S transition of human lung adenocarcinoma cells.

Sequence

Synthetic peptide located within the following region: VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Zengyi Ma et al.
International journal of clinical and experimental pathology, 6(5), 862-869 (2013-05-03)
Cohesin, a multiunit complex of SMC1A, SMC3 and Rad21, associates with chromatin after mitosis and holds sister chromatids together following DNA replication. It has been reported that SMC1A is mutated in some cancer types, leading to genomic instability and abnormal
Magtouf Gatei et al.
The Journal of biological chemistry, 286(36), 31542-31556 (2011-07-16)
The Mre11/Rad50/NBN complex plays a central role in coordinating the cellular response to DNA double-strand breaks. The importance of Rad50 in that response is evident from the recent description of a patient with Rad50 deficiency characterized by chromosomal instability and
Yi-Fan Zhang et al.
Oncology letters, 5(3), 749-755 (2013-02-22)
SMC1A (structural maintenance of chromosomes 1A), which encodes a structural subunit of the cohesin protein complex, is necessary for the process of sister chromatid cohesion during the cell cycle. Mutation and deregulation of SMC1A are highly relevant to diverse human

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service