WH0003340M1

Monoclonal Anti-NDST1 antibody produced in mouse

clone 1G10, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-HSST, Anti-N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1, Anti-NST1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1G10, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_001543
• UniProt accession no.: P52848
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NDST1(3340)

Description

General description

NDST1 (N-deacetylase and N-sulfotransferase 1) is a bifunctional enzyme that has both N-deacetylase and N-sulfotransferase activities. This gene is located on human chromosome 5q33.

Immunogen

NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI

Biochem/physiol Actions

The enzyme coded by NDST1 (N-deacetylase and N-sulfotransferase 1) gene participates in the first step in the production of heparan sulfate chains and proteoglycans. This enzyme also plays a major role in generating the GlcNS (N-sulfo glucosamine) residues.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves