Key Documents

View All Documentation

Anti-RDM1

Name: Anti-RDM1
Brand: SIGMA
Price: 6190 SEK

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody

Synonym(s):

MGC33977, RAD52B

Select a Size

Change View

Pack Size	SKU	Availability	Price
100 μL		Please contact Customer Service for Availability	6 190,00 kr

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA067546

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

6 190,00 kr

Please contact Customer Service for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:500-1:1000

Related Categories

Prestige Antibodies^® Powered by Atlas Antibodies

Enhanced Validation Antibodies

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA024794	HPA057265	HPA052291
Sigma-Aldrich HPA067546 Anti-RDM1	Sigma-Aldrich HPA024794 Anti-RDM1 antibody produced in rabbit	Sigma-Aldrich HPA057265 Anti-RRM1 antibody produced in rabbit	Sigma-Aldrich HPA052291 Anti-RAD50 antibody produced in rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution
storage temp. −20°C	storage temp. −20°C	storage temp. −20°C	storage temp. −20°C

Immunogen

Recombinant protein corresponding to RAD52 motif containing 1

Sequence
AELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHR

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Other Notes

Corresponding Antigen APREST93973

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

R102473

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Global Trade Item Number

SKU	GTIN
HPA067546-100UL	04061835312757
HPA067546-25UL	04061841304012

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service