Key Documents

Anti-CARMIL2 antibody produced in rabbit

Name: Anti-CARMIL2 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-LRRC16C, Anti-RLTPR, Anti-Carmil2, Anti-Lrrc16c, Anti-Rgd motif, leucine rich repeats, tropomodulin domain and proline-rich containing

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA041402

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

$667.00

Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RLTPR(146206)

Description

General description

The gene CARMIL2 (capping protein regulator and myosin 1 linker 2) is mapped to human chromosome 16q22.1. The encoded protein belongs to the CARMIL family of proteins. The protein has a noncanonical pleckstrin homology domain, a leucine-rich repeat domain, a helical homodimerization domain and a disordered region that contains the CBR (CP-binding region) and a proline-rich domain, which binds to class-I myosins. CARMIL2 is also referred to as RLTPR (RGD, leucine-rich repeat, tropomodulin and proline-rich-containing protein).

Immunogen

capping protein regulator and myosin 1 linker 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-RLTPR antibody produced in rabbit has been used in western blotting.[1]

Biochem/physiol Actions

CARMIL (capping protein regulator and myosin 1 linker) proteins are mainly involved in cell migration. CARMIL proteins interact with capping protein (CP). In migrating cells, CARMIL2 (also referred to as RLTPR) regulates cell polarity. It also interacts with vimentin intermediate filaments. CARMIL2 is needed for cell migration in wound healing and invadopodia-induced matrix degradation.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST82234

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA029039	HPA029038	HPA017950
Sigma-Aldrich HPA041402 Anti-CARMIL2 antibody produced in rabbit	Sigma-Aldrich HPA029039 Anti-CARMIL1 antibody produced in rabbit	Sigma-Aldrich HPA029038 Anti-CARMIL1 antibody produced in rabbit	Sigma-Aldrich HPA017950 Anti-LRRC8B antibody produced in rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
Gene Information human ... RLTPR(146206)	Gene Information human ... LRRC16A(55604)	Gene Information human ... LRRC16A(55604)	Gene Information human ... LRRC8B(23507)

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c