Autenticati per visualizzare i prezzi organizzativi e contrattuali.
Scegli un formato
Cambia visualizzazione
Informazioni su questo articolo
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
6
Servizio Tecnico
Hai bisogno di aiuto? Il nostro team di scienziati qualificati è a tua disposizione.
Permettici di aiutartibiological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50
immunogen sequence
IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PCBP2(5094)
General description
Poly (rC) binding protein 2 (PCBP2), also known as heterogeneous ribonuclear protein E2 (hnRNP E2) and αCP2, belongs to a group of proteins that bind to poly(C) stretches of both RNA and DNA and is encoded by the gene mapped to human chromosome 12q13.13. The encoded protein is a key constituent of stress granules (SG) and processing bodies (P-body). The protein shuttles between cytoplasm and nucleus.
Immunogen
poly(rC) binding protein 2 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-PCBP2 antibody produced in rabbit has been used in fully automated and standardized-individual-nucleotide resolution cross-linking and immunoprecipitation (FAST- iCLIP).
Biochem/physiol Actions
Poly (rC) binding protein 2 (PCBP2) plays a vital role in controlling mRNA stability and regulating translation 14. In addition, it can also take part in protein-protein interactions. The encoded protein functions as a negative regulator of mitochondrial antiviral-signaling protein (MAVS)-mediated antiviral signaling via interacting with HECT (homologous to the E6-AP carboxyl terminus) domain -containing E3 ligase AIP4. Dysregulated expression of the gene results in oral cancer. PCBP2 plays a vital role as an initiator of internal ribosomal entry site (IRES)-mediated translation of both viral and cellular mRNA. Additionally, it also facilitates many biological processes, such as transcriptional regulation and translational silencing. Elevated expression of PCBP2 has been observed in human glioma tissues and cell lines. Downregulation of this gene, by the inhibition of cell-cycle progression and activation of caspase-3–mediated apoptosis, retards glioma growth in vitro and in vivo.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST81245
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Classe di stoccaggio
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Scegli una delle versioni più recenti:
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
PCBP2 mediates degradation of the adaptor MAVS via the HECT ubiquitin ligase AIP4.
You F
Nature Immunology, 10, 1300-1308 (2009)
Ryan A Flynn et al.
RNA (New York, N.Y.), 21(1), 135-143 (2014-11-21)
RNA-protein interactions are central to biological regulation. Cross-linking immunoprecipitation (CLIP)-seq is a powerful tool for genome-wide interrogation of RNA-protein interactomes, but current CLIP methods are limited by challenging biochemical steps and fail to detect many classes of noncoding and nonhuman
Dissecting noncoding and pathogen RNA-protein interactomes.
Flynn RA
RNA, 21, 135-143 (2015)
Numero articolo commerciale globale
| SKU | GTIN |
|---|---|
| HPA038356-25UL | 04061842938230 |
| HPA038356-100UL | 04061836356828 |