HPA038211

Anti-SIK1 antibody produced in rabbit

Name: Anti-SIK1 antibody produced in rabbit
Brand: SIGMA
Price: 61116.6 INR

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-SNF1LK, Anti-msk

Slide 1 of 1

Select a Size

100 μL

₹61,116.60

Please contact Customer Service for Availability

About This Item

UNSPSC Code:

12352203

NACRES:

NA.43

Human Protein Atlas Number:

HPA038211

Key Documents

View All Documentation

Product Name

Anti-SIK1 antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

YLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFPVDASCSGVF

UniProt accession no.

P57059

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	HPA007932	HPA024177	SAB4300527
Sigma-Aldrich HPA038211 Anti-SIK1 antibody produced in rabbit	Sigma-Aldrich HPA007932 Anti-CDK7 antibody produced in rabbit	Sigma-Aldrich HPA024177 Anti-SIKE1 antibody produced in rabbit	Sigma-Aldrich SAB4300527 Anti-RPS6KB1 (Ab-424) antibody produced in rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -
storage temp. −20°C	storage temp. −20°C	storage temp. −20°C	storage temp. −20°C

Biochem/physiol Actions

Serine/threonine-protein kinase (SIK1) interacts with mothers against decapentaplegic homolog 7 (SMAD7) and regulates transforming growth factor β (TGFβ) signalling. SIK1 is associated with tuning of circadian rhythms. SIK1 modulates intracellular sodium levels by coordinating with Na⁺,K⁺-ATPase. Mutations in the SIK1 gene is implicated in epilepsy disorder. A truncated SIK1 protein contributes to developmental epilepsy.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-SIK1 antibody produced in rabbit has been used in the detection of SIK1 protein in human tumor samples using immunohistochemistry.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

General description

Serine/threonine-protein kinase (SIK1) also called salt-inducible kinase 1 or sucrose nonfermented 1-like kinase is a serine/threonine kinase. SIK has an N-terminal kinase domain, a central ubiquitin-associated (UBA) domain. SIK1 is mapped to human chromosome 21q22.3.

Immunogen

salt-inducible kinase 1

Other Notes

Corresponding Antigen APREST87281

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

R35575

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

De novo mutations in SIK1 cause a spectrum of developmental epilepsies

Hansen J, et al.

American Journal of Human Genetics, 96(4), 682-690 (2015)

SIK1 is part of a cell sodium-sensing network that regulates active sodium transport through a calcium-dependent process

Sjostrom M, et al.

Proceedings of the National Academy of Sciences of the USA, 104(43), 16922-16927 (2007)

snf1lk encodes a protein kinase that may function in cell cycle regulation

Stephenson A, et al.

Genomics, 83(6), 1105-1115 (2004)

The protein kinase SIK downregulates the polarity protein Par3

Vanlandewijck M, et al.

Oncotarget, 9(5), 5716-5716 (2018)

Epilepsy-causing sequence variations in SIK1 disrupt synaptic activity response gene expression and affect neuronal morphology

Proschel C, et al.

European Journal of Human Genetics, 25(2), 216-216 (2017)

View All Related Papers

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service