HPA036646

Anti-STT3B antibody produced in rabbit

Name: Anti-STT3B antibody produced in rabbit
Brand: SIGMA
Price: 482 CHF

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-FLJ90106, Anti-SIMP, Anti-STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae), Anti-STT3-B

Slide 1 of 2

Autenticati per visualizzare i prezzi organizzativi e contrattuali.

Scegli un formato

100 μL

CHF 482.00

Per conoscere la disponibilità, visualizza il carrello

Informazioni su questo articolo

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA036646

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

Documenti fondamentali

Visualizza tutta la documentazione

Vai a

Servizio Tecnico

Hai bisogno di aiuto? Il nostro team di scienziati qualificati è a tua disposizione.

Permettici di aiutarti

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000

immunogen sequence

NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP

UniProt accession no.

Q8TCJ2

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... STT3B(201595)

Cerchi prodotti simili? Visita Guida al confronto tra prodotti

Categorie correlate

Antibodies - Primary, Secondary & Recombinant Monoclonal

Antibodies by Application

Primary Antibodies

Confronta articoli simili

Visualizza il confronto per intero

Mostra le differenze

1 of 4

Questo articolo	HPA036448	HPA050329	SAB5700069
Sigma-Aldrich HPA036646 Anti-STT3B antibody produced in rabbit	Sigma-Aldrich HPA036448 Anti-STT3B antibody produced in rabbit	Sigma-Aldrich HPA050329 Anti-SIN3B antibody produced in rabbit	Sigma-Aldrich SAB5700069 Anti-STAT3 antibody produced in rabbit
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate -
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -
technique(s) immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000	technique(s) immunohistochemistry: 1:50- 1:200	technique(s) immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500	technique(s) immunofluorescence: 1:50-1:200, western blot: 1:500-1:2000

Immunogen

STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST79437

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?

Prova il nostro Motore di ricerca dei prodotti.

Classe di stoccaggio

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

R34009

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Magnesium transporter 1 (MAGT1) deficiency causes selective defects in N-linked glycosylation and expression of immune-response genes.

Mami Matsuda-Lennikov et al.

The Journal of biological chemistry, 294(37), 13638-13656 (2019-07-25)

Magnesium transporter 1 (MAGT1) critically mediates magnesium homeostasis in eukaryotes and is highly-conserved across different evolutionary branches. In humans, loss-of-function mutations in the MAGT1 gene cause X-linked magnesium deficiency with Epstein-Barr virus (EBV) infection and neoplasia (XMEN), a disease that

Comprehensive Interactome Analysis Reveals that STT3B Is Required for N-Glycosylation of Lassa Virus Glycoprotein.

Shenglin Zhu et al.

Journal of virology, 93(23) (2019-09-13)

Lassa virus (LASV) is the causative agent of a fatal hemorrhagic fever in humans. The glycoprotein (GP) of LASV mediates viral entry into host cells, and correct processing and modification of GP by host factors is a prerequisite for virus

Genetic dissection of Flaviviridae host factors through genome-scale CRISPR screens.

Caleb D Marceau et al.

Nature, 535(7610), 159-163 (2016-07-08)

The Flaviviridae are a family of viruses that cause severe human diseases. For example, dengue virus (DENV) is a rapidly emerging pathogen causing an estimated 100 million symptomatic infections annually worldwide. No approved antivirals are available to date and clinical

Numero articolo commerciale globale

SKU	GTIN
HPA036646-100UL	04061836354152
HPA036646-25UL	04061841601401

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica