Key Documents

Anti-GCNT2 antibody produced in rabbit

Name: Anti-GCNT2 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-I-branching enzyme, Anti-IGNT, Anti-N-acetylglucosaminyltransferase, Anti-N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Check Cart for Availability	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA026776

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

$667.00

Check Cart for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

EVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDT

UniProt accession no.

Q8N0V5

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GCNT2(2651)

Description

General description

Glucosaminyl (N-acetyl) transferase 2 (GCNT2) protein is encoded by the novel metastasis-related gene mapped to human chromosome 6p24. The GCNT2 protein belongs to the β-1, 6-N-acetylglucosaminyltransferase family, which has an essential role in glycosylation.

Immunogen

N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

Glucosaminyl (N-acetyl) transferase 2 (GCNT2) is an enzyme essential for the development of the blood group I antigen. Biallelic mutation of GCNT2 leads to autosomal recessive congenital cataracts and the rare adult i blood group. GCNT2 associates with β1,3-N-acetylglucosminyltransferase 2(β3GnT2) to regulate the PLN levels in olfactory neurons by modulating β1, 6-branches that aids in Poly-N-acetyllactosamine (PLN) extension. Over human developmental stage, GCNT2 enzyme transforms linear i-antigen to I-branching glycan by replacing GlcNAc of uridine diphosphate–GlcNAc with galactose β1-6 linkage of linear lactosamine chains. Uprooted expression of GCNT2 enzyme increases cell detachment, cell adhesion, cell migration and invasion in vitro, and lung metastasis of breast cancer cells in vivo. Overexpression of GCNT2 contributes to breast cancer metastasis. Transforming growth factor-β1 (TGF-β1) acts as an effector of GCNT2 enzyme and plays a major role in TGF-β1induced epithelial-to-mesenchymal transition (EMT).

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71799

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA031151	HPA011154	HPA037431
Sigma-Aldrich HPA026776 Anti-GCNT2 antibody produced in rabbit	Sigma-Aldrich HPA031151 Anti-GCNT1 antibody produced in rabbit	Sigma-Aldrich HPA011154 Anti-GCNT3 antibody produced in rabbit	Sigma-Aldrich HPA037431 Anti-GCNT4 antibody produced in rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c