Key Documents

View All Documentation

Anti-TMEM245 antibody produced in rabbit

Name: Anti-TMEM245 antibody produced in rabbit
Brand: SIGMA
Price: 4210 DKK

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-C9orf5, Anti-Protein CG-2

Select a Size

Change View

Pack Size	SKU	Availability	Price
100 μL		Please contact Customer Service for Availability	4.210,00 kr.

About This Item

UNSPSC Code:

12352203

NACRES:

NA.43

Human Protein Atlas Number:

HPA023892

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

4.210,00 kr.

Please contact Customer Service for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:1000-1:2500

immunogen sequence

AELPGQVISMAASTLANLAISITGYESSSEDQPSTQPAEAVDRGESAPTLSTSPSPSSPSPTSPSPTLGRRRPEIGTFLRKKK

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... C9orf5(23731)

Description

General description

Transmembrane protein 245 (TMEM245), also called as CG-2 or chromosome 9 open reading frame 5 (C9ORF5) gene, is mapped to a region of human chromosome 9q31-33 with 18 exons spanning 110kb, and associated with familial dysautonomia. This gene codes for 911 amino acid transmembrane protein with an estimated molecular weight of 101kDa. The TMEM245 mRNA is expressed in all adult and fetal tissues except adult thymus. Polymorphism of C9ORF5 is affiliated with information processing speed, which is a vital cognitive function.

Immunogen

Transmembrane protein C9orf5 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST75191

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA014918	HPA009078	HPA042081
Sigma-Aldrich HPA023892 Anti-TMEM245 antibody produced in rabbit	Sigma-Aldrich HPA014918 Anti-TMEM243 antibody produced in rabbit	Sigma-Aldrich HPA009078 Anti-TMEM230 antibody produced in rabbit	Sigma-Aldrich HPA042081 Anti-TMEM231 antibody produced in rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
technique(s) immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:1000-1:2500	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:20-1:50	technique(s) immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

R11447

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Cloning, genomic organization and expression of a putative human transmembrane protein related to the Caenorhabditis elegans M01F1.4 gene.

Chadwick BP

Gene, 240(1), 67-73 (1999)

BCL9 and C9orf5 are associated with negative symptoms in schizophrenia: meta-analysis of two genome-wide association studies.
BCL9 and C9orf5 are associated with negative symptoms in schizophrenia: meta-analysis of two genome-wide association studies.

Xu C

PLoS ONE, 8(1) (2013)

Global Trade Item Number

SKU	GTIN
HPA023892-100UL	04061835671984
HPA023892-25UL	04061841473510

Questions

Reviews

No rating value