Kluczowe dokumenty

Wyświetl całą dokumentację

Przejdź do

HPA023608

Anti-SURF6 antibody produced in rabbit

Name: Anti-SURF6 antibody produced in rabbit
Brand: SIGMA
Price: 2400 PLN

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

Anti-Surfeit locus protein 6

Zaloguj się, aby wyświetlić ceny organizacyjne i kontraktowe.

Wybierz wielkość

Zmień widok

Do Państwa/SKU	Dostępność	Cena netto
100 μL	Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności	2400,00 zł

Informacje o tej pozycji

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA023608

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

2400,00 zł

Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności

Pomoc techniczna

Potrzebujesz pomocy? Nasz zespół doświadczonych naukowców chętnie Ci pomoże.

Pozwól nam pomóc

Właściwości

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000

immunogen sequence

AKDAYLQSLAKKICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKAKSLGEKSPAASGARRPEAAKEEAAWASSSAGNPADGLATEPESVFALDVLRQRLHEKIQE

UniProt accession no.

O75683

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SURF6(6838)

Opis

General description

The gene SURF6 (surfeit 6) encodes a member of the Surfeit locus that is found to be localized to the nucleolus. The encoded protein is a unique component of the nucleolar matrix system with no sequence similarity with any other known protein.

Immunogen

Surfeit locus protein 6 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

The gene SURF6 (surfeit 6) encodes a protein that has the ability to bind to nucleic-acids, with more affinity for RNA. It is found to be a structural protein that is present at all stages of the cell cycle in nucleolar substructures. It may be involved in the structure and functions of the nucleolar matrix by associating with nucleic acids. It may also be involved in rRNA (ribosomal RNA) processing.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST86852

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Ta strona może zawierać tekst przetłumaczony maszynowo.

Porównaj podobne pozycje

Wyświetl pełne porównanie

Pokaż różnice

1 of 1

Ta pozycja	HPA074622	SAB2108065	HPA064613
Sigma-Aldrich HPA023608 Anti-SURF6 antibody produced in rabbit	Sigma-Aldrich HPA074622 Anty-SURF6	Sigma-Aldrich SAB2108065 Anti-SURF4 antibody produced in rabbit	Sigma-Aldrich HPA064613 Anti-SURF4
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody	description affinity isolated antibody	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line Prestige Antibodies^® Powered by Atlas Antibodies
Gene Information human ... SURF6(6838)	Gene Information human ... SURF6(6838)	Gene Information human ... SURF4(6836)	Gene Information human ... SURF4(6836)

Still not finding the right product?

Explore all of our products under Anti-SURF6 antibody produced in rabbit

— lub —

Wypróbuj nasze narzędzie Narzędzie selektora produktów, aby zawęzić opcje.

Klasa składowania

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c