HPA023040

Anti-KRT14 antibody produced in rabbit

Name: Anti-KRT14 antibody produced in rabbit
Brand: SIGMA
Price: 494 CHF

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-CK-14, Anti-Cytokeratin-14, Anti-K14, Anti-Keratin, type I cytoskeletal 14, Anti-Keratin-14

Slide 1 of 4

Autenticati per visualizzare i prezzi organizzativi e contrattuali.

Scegli un formato

100 μL

CHF 494.00

Per conoscere la disponibilità, visualizza il carrello

Per il tuo target è disponibile un anticorpo ricombinante privo di conservanti. Prova ZRB1441

Informazioni su questo articolo

UNSPSC Code:

12352203

NACRES:

NA.43

Human Protein Atlas Number:

HPA023040

Documenti fondamentali

Visualizza tutta la documentazione

Vai a

Servizio Tecnico

Hai bisogno di aiuto? Il nostro team di scienziati qualificati è a tua disposizione.

Permettici di aiutarti

Nome del prodotto

Anti-KRT14 antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:1000-1:2500

immunogen sequence

TYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

UniProt accession no.

P02533

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Confronta articoli simili

Visualizza il confronto per intero

Mostra le differenze

1 of 4

Questo articolo	AV15002	SAB1410738	AV41733
Sigma-Aldrich HPA023040 Anti-KRT14 antibody produced in rabbit	$Anti-KRT14 antibody produced in rabbit IgG fraction of antiserum$ Sigma-Aldrich AV15002 Anti-KRT14 antibody produced in rabbit	Sigma-Aldrich SAB1410738 Anti-KRT4 antibody produced in rabbit	Sigma-Aldrich AV41733 Anti-KRT17 antibody produced in rabbit
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form affinity isolated antibody	antibody form IgG fraction of antiserum	antibody form purified immunoglobulin	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line -	product line -
shipped in wet ice	shipped in wet ice	shipped in dry ice	shipped in wet ice

Application

Anti-KRT14 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

CK14/ KRT14 (keratin 14) participates in collective invasion of salivary adenoid cystic carcinoma (SACC). Mutations in KRT14 results in epidermolysis bullosa simplex.

KRT14 (keratin 14) is required for the generation of a perinuclear structure of keratin filaments in keratinocytes. It is a key player in the assembly, organization and dynamics of keratin filaments. Mutations in KRT14 are associated with epidermolysis bullosa simplex. The gene is mapped to human chromosome 17q21.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

General description

CK14/ KRT14 (keratin 14) is one of the cytokeratin isotypes of human cells. It is an intermediate filament protein. It is located on human chromosome 17q21.

Immunogen

Keratin, type I cytoskeletal 14 recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST75948

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Non trovi il prodotto giusto?

Prova il nostro Motore di ricerca dei prodotti.

Classe di stoccaggio

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

A40100

R10966

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Novel de novo mutation in KRT14 underlies a localized form of epidermolysis bullosa simplex.

Monika Ołdak et al.

European journal of dermatology : EJD, 23(3), 404-406 (2013-06-19)

Full thickness 3D in vitro conjunctiva model enables goblet cell differentiation.

Julian Schwebler et al.

Scientific reports, 13(1), 12261-12261 (2023-07-29)

In vitro culture and generation of highly specialized goblet cells is still a major challenge in conjunctival 3D in vitro equivalents. A model comprising all physiological factors, including mucus-secreting goblet cells has the potential to act as a new platform

Progress toward Treatment and Cure of Epidermolysis Bullosa: Summary of the DEBRA International Research Symposium EB2015.

Jouni Uitto et al.

The Journal of investigative dermatology, 136(2), 352-358 (2016-01-24)

Epidermolysis bullosa (EB), a group of complex heritable blistering diseases, is the topic of triennial research meetings organized by DEBRA International, Vienna, Austria, the network of national EB patient advocacy organizations. The DEBRA 2015 Research Conference, held in May 2015

A preclinical model of cutaneous melanoma based on reconstructed human epidermis.

Anna Leikeim et al.

Scientific reports, 12(1), 16269-16269 (2022-09-30)

Malignant melanoma is among the tumor entities with the highest increase of incidence worldwide. To elucidate melanoma progression and develop new effective therapies, rodent models are commonly used. While these do not adequately reflect human physiology, two-dimensional cell cultures lack

Vector-borne Trypanosoma brucei parasites develop in artificial human skin and persist as skin tissue forms.

Christian Reuter et al.

Nature communications, 14(1), 7660-7660 (2023-11-24)

Transmission of Trypanosoma brucei by tsetse flies involves the deposition of the cell cycle-arrested metacyclic life cycle stage into mammalian skin at the site of the fly's bite. We introduce an advanced human skin equivalent and use tsetse flies to

Visualizza tutti i documenti correlati

Contenuto correlato

Procedure for Fixation Immunostaining and Imaging in 384-well Plates

Prestige Antibodies Immunofluorescence Procedure

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica