Wichtige Dokumente

Gesamtdokumentation anzeigen

Fortfahren mit

HPA019543

Anti-SFXN1 antibody produced in rabbit

Name: Anti-SFXN1 antibody produced in rabbit
Brand: SIGMA
Price: 409.7 CHF

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-Sideroflexin-1, Anti-TCC, Anti-Tricarboxylate carrier protein

zur Ansicht der Organisations- und Vertragspreise.

Größe auswählen

Ansicht ändern

Ihnen/SKU	Verfügbarkeit	Preis
100 μL	Warenkorb auf Verfügbarkeit prüfen	CHF 482.00 CHF 409.70

Über diesen Artikel

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA019543

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

CHF 409.70

ListenpreisCHF 482.00Sparen Sie 15%

Aktion nur im Web

Warenkorb auf Verfügbarkeit prüfen

Technischer Dienst

Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.

Unterstützung erhalten

Eigenschaften

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, human, mouse

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

SGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQV

UniProt accession no.

Q9H9B4

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SFXN1(94081)

Beschreibung

General description

SFXN1 (sideroflexin 1) also known as TCC (tricarboxylate (citrate) carrier (TCC) is a mitochondrial transmembrane protein belonging to the sideroflexin family. It is majorly associated with iron metabolism. TCC is an important component of the shuttle system, involving the transportation of mitochondrial acetyl-CoA into the cytosol, where lipogenesis (fatty acid synthesis) occurs.

Immunogen

Sideroflexin-1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

SFXN1 (sideroflexin 1) is highly involved in the hepatic intermediary metabolism. It has been counted as candidate genes for sideroblastic anemia through a series of experiments.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73044

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ähnliche Artikel vergleichen

Vollständigen Vergleich anzeigen

Unterschiede anzeigen

1 of 1

Dieser Artikel	HPA026834	HPA008028	HPA056866
Sigma-Aldrich HPA019543 Anti-SFXN1 antibody produced in rabbit	Sigma-Aldrich HPA026834 Anti-SFXN2 antibody produced in rabbit	Sigma-Aldrich HPA008028 Anti-SFXN3 antibody produced in rabbit	Sigma-Aldrich HPA056866 Anti-SFXN5 antibody produced in rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
storage temp. −20°C	storage temp. −20°C	storage temp. −20°C	storage temp. −20°C
species reactivity rat, human, mouse	species reactivity human	species reactivity rat, mouse, human	species reactivity human

Still not finding the right product?

Probieren Sie unser Produkt-Auswahlhilfe, um Ihre Auswahl einzugrenzen

Lagerklasse

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c