HPA017736

Anti-HS3ST2 antibody produced in rabbit

Name: Anti-HS3ST2 antibody produced in rabbit
Brand: SIGMA

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Heparan sulfate 3-O-sulfotransferase 2, Anti-Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2, Anti-Heparan sulfate glucosamine 3-O-sulfotransferase 2, Anti-h3-OST-2

Slide 1 of 1

Select a Size

Pricing and availability is not currently available.

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA017736

Key Documents

View All Documentation

Product Name

Anti-HS3ST2 antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

APRCLRGPSAGGQKLLQKSRPCDPSGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDVRALGTEPHFFDRNYGRG

UniProt accession no.

Q9Y278

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	HPA043603	HPA056189	HPA051515
Sigma-Aldrich HPA017736 Anti-HS3ST2 antibody produced in rabbit	Sigma-Aldrich HPA043603 Anti-HS2ST1 antibody produced in rabbit	Sigma-Aldrich HPA056189 Anti-NDST3 antibody produced in rabbit	Sigma-Aldrich HPA051515 Anti-NDST2 antibody produced in rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
UniProt accession no. Q9Y278	UniProt accession no. Q7LGA3	UniProt accession no. O95803	UniProt accession no. P52849

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

Heparan sulfate glucosamine 3-O-sulfotransferase 2 (HS3ST2) is involved in generating rare 3-O-sulphated domains in heparan sulphates and takes part in the final modification step during biosynthesis of heparan sulphate. HS3ST2 has a heparan sulfate glucosaminyl 3-O-sulfotransferase activity which carries out the 3-O-sulfation of glucosamine residues, thus leading to a modification in glycosaminoglycan (GAG) chains. This enzyme has the capacity to generate herpes simplex virus type-1 (HSV-1) entry receptors. Studies have shown that its expression makes Chinese hamster ovary K1 (CHO-K1) cells prone to HSV-1 infection. HS3ST2 may act as a therapeutic target for Alzheimer′s disease.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

General description

Heparan sulfate glucosamine 3-O-sulfotransferase 2 (HS3ST2) is expressed in neurons. It is part of the heparan sulfate biosynthetic enzyme family and the gene encoding it is localized on chromosome 16.

Immunogen

Heparan sulfate glucosamine 3-O-sulfotransferase 2 recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST71869

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

R07115

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A role for heparan sulfate 3-O-sulfotransferase isoform 2 in herpes simplex virus type 1 entry and spread.

Christopher D O'Donnell et al.

Virology, 346(2), 452-459 (2005-12-13)

Heparan sulfate (HS) 3-O-sulfotransferase isoform-2 (3-OST-2), which belongs to a family of enzymes capable of generating herpes simplex virus type-1 (HSV-1) entry and spread receptors, is predominantly expressed in human brain. Despite its unique expression pattern, the ability of 3-OST-2

Epigenetic inactivation of heparan sulfate (glucosamine) 3-O-sulfotransferase 2 in lung cancer and its role in tumorigenesis.

Jung-Ah Hwang et al.

PloS one, 8(11), e79634-e79634 (2013-11-23)

This study was aimed at investigating the functional significance of heparan sulfate (glucosamine) 3-O-sulfotransferase 2 (HS3ST2) hypermethylation in non-small cell lung cancer (NSCLC). HS3ST2 hypermethylation was characterized in six lung cancer cell lines, and its clinical significance was analyzed using

Multiple isoforms of heparan sulfate D-glucosaminyl 3-O-sulfotransferase. Isolation, characterization, and expression of human cdnas and identification of distinct genomic loci.

N W Shworak et al.

The Journal of biological chemistry, 274(8), 5170-5184 (1999-02-13)

3-O-Sulfated glucosaminyl residues are rare constituents of heparan sulfate and are essential for the activity of anticoagulant heparan sulfate. Cellular production of the critical active structure is controlled by the rate-limiting enzyme, heparan sulfate D-glucosaminyl 3-O-sulfotransferase-1 (3-OST-1) (EC 2.8.2.23). We

HS3ST2 expression is critical for the abnormal phosphorylation of tau in Alzheimer's disease-related tau pathology.

Julia Elisa Sepulveda-Diaz et al.

Brain : a journal of neurology, 138(Pt 5), 1339-1354 (2015-04-07)

Heparan sulphate (glucosamine) 3-O-sulphotransferase 2 (HS3ST2, also known as 3OST2) is an enzyme predominantly expressed in neurons wherein it generates rare 3-O-sulphated domains of unknown functions in heparan sulphates. In Alzheimer's disease, heparan sulphates accumulate at the intracellular level in

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service