Key Documents

View All Documentation

Anti-SEC62 antibody produced in rabbit

Name: Anti-SEC62 antibody produced in rabbit
Brand: SIGMA
Price: 607 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-TP-1, Anti-Translocation protein 1, Anti-Translocation protein SEC62, Anti-hTP-1

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)	$607.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA014059

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

$607.00

Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSS

UniProt accession no.

Q99442

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SEC62(7095)

Description

Immunogen

Translocation protein SEC62 recombinant protein epitope signature tag (PrEST)

Application

Anti-SEC62 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting.[1][2] To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

The gene SEC62 is also referred to as TLOC1 (trasnlocation 1) and is mapped to human chromosome 3q26.2. It forms a subunit of the endoplasmic reticulum protein translocation machinery. In yeast, the endoplasmic reticulum membrane transport complex consists of the trimeric Sec61p complex and the Sec62p-Sec63p subcomplex. In mammalian cells, the protein SEC62 is found to be associated with Sec61 complex, which suggests its role in transport processes similar to those observed by the yeast Sec complex. The exact function of this protein in mammalian cells is yet to be determined. This protein is found to be overexpressed in prostate cancer cells and may serve as a potential diagnostic or prognostic marker in prostate cancer.[1] The gene SEC62 has been identified as a driver gene along with a second 3q26 gene, SKIL (SNON). These two genes have been found to cooperate to produce a tumorigenic phenotype.[1]

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST72817

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA053295	HPA018166	ABC830
Sigma-Aldrich HPA014059 Anti-SEC62 antibody produced in rabbit	Sigma-Aldrich HPA053295 Anti-SEC63 antibody produced in rabbit	Sigma-Aldrich HPA018166 Anti-RRP1 antibody produced in rabbit	Sigma-Aldrich ABC830 Anti-SEC62 Antibody
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -
Gene Information human ... SEC62(7095)	Gene Information human ... SEC63(11231)	Gene Information human ... RRP1(8568)	Gene Information human ... SEC62(7095)

Still not finding the right product?

Explore all of our products under Anti-SEC62 antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.