Key Documents

Anti-C1GALT1 antibody produced in rabbit

Name: Anti-C1GALT1 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Beta 1,3-galact, Anti-C1GalT1, Anti-Core 1 beta1,3-galactosyltransferase 1, Anti-Core 1 beta3-Gal-T, Anti-Core1 UDP- galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1, Anti-Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA011294

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

$667.00

Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:20-1:50

immunogen sequence

VDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIK

UniProt accession no.

Q9NS00

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... C1GALT1(56913)

Description

General description

C1GALT1 (core 1 synthase, glycoprotein-N-acetylgalactosamine 3-β-galactosyltransferase 1) is a mucin-type O-glycosyltransferase, which resides in Golgi bodies. It is a type II transmembrane protein with its N-terminal facing the cytosol. Its transmembrane domain is made of 26 amino acids, and its functional domain is made of 331 amino acids and faces the lumen.

Immunogen

core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

C1GALT1 (core 1 synthase, glycoprotein-N-acetylgalactosamine 3-β-galactosyltransferase 1) catalyzes the transfer of galactose (Gal) to N-acetylgalactosamine (GalNAc) of a serine (Ser) or threonine (Thr) residue (Tn antigen) to form the Galβ1-3GalNAcα1-Ser/Thr structure. This structure is called the T antigen or core 1 structure, which acts as the precursor for maturation of mucin-type O-glycans. This protein is also involved in the control of kidney development, thrombopoiesis and angiogenesis. It is up-regulated in hepatocellular carcinoma (HCC) and is responsible for enhanced proliferation of HCC cells. This is achieved by the activation of hepatocyte growth factor (HGF) by C1GALT1, through modulation of MET O-glycosylation. It is responsible for the enhanced invasiveness of colon cancer via the modification of the O-glycosylation of FGFR2 (fibroblast growth factor receptor 2).[1] Polymorphisms in C1GLAT1 gene are linked with Henoch-Schönlein purpura in Chinese population.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71747

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA012819	HPA010666	HPA010807
Sigma-Aldrich HPA011294 Anti-C1GALT1 antibody produced in rabbit	Sigma-Aldrich HPA012819 Anti-C1GALT1 antibody produced in rabbit	Sigma-Aldrich HPA010666 Anti-C1GALT1C1 antibody produced in rabbit	Sigma-Aldrich HPA010807 Anti-B4GALT1 antibody produced in rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
clone polyclonal	clone polyclonal	clone polyclonal	clone polyclonal

Still not finding the right product?

Explore all of our products under Anti-C1GALT1 antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c