Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| 100 μL | Estimated to ship TODAYfromSAINT LOUIS | $667.00 |
About This Item
$667.00
Estimated to ship TODAYDetails
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, mouse
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200
immunogen sequence
YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... B4GALT3(8703)
General description
Immunogen
Application
Biochem/physiol Actions
Features and Benefits
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Other Notes
Legal Information
Disclaimer
1 of 1
This Item | |||
|---|---|---|---|
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| Quality Level 100 | Quality Level 100 | Quality Level 100 | Quality Level 100 |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies |
| Gene Information human ... B4GALT3(8703) | Gene Information human ... B4GALT1(2683) | Gene Information human ... B4GALT1(2683) | Gene Information human ... GALNT3(2591) |
Still not finding the right product?
Explore all of our products under Anti-B4GALT3 antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Related Content
Prestige Antibodies Immunofluorescence Procedure
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA010793-25UL | 04061842816910 |
| HPA010793-100UL | 04061837125423 |



