Principaux documents

Voir toute la documentation

Passer à

HPA007044

Anti-HK1 antibody produced in rabbit

Name: Anti-HK1 antibody produced in rabbit
Brand: SIGMA
Price: 514 EUR

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Brain form hexokinase antibody produced in rabbit, Anti-HK I antibody produced in rabbit, Anti-Hexokinase type I antibody produced in rabbit, Anti-Hexokinase-1 antibody produced in rabbit

Se connecter pour consulter les tarifs organisationnels et contractuels.

Sélectionner une taille de conditionnement

Changer de vue

À vous/Référence	Disponibilité	Prix
100 μL	Vérifier la disponibilité des articles du panier	514,00 €

A propos de cet article

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA007044

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

514,00 €

Vérifier la disponibilité des articles du panier

Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB2025

Service technique

Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.

Laissez-nous vous aider

Propriétés

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

LPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLN

UniProt accession no.

P19367

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HK1(3098)

Description

Immunogen

Hexokinase-1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

HK1 (Hexokinase 1) encodes a hexokinase protein consisting of a porin-binding domain at the N-terminal end. It is majorly involved in the glucose metabolic pathway. It is expressed in the photoreceptor inner section, outer plexiform layer, inner nuclear layer, inner plexiform layer, and ganglion cell layer of the human retina. It provides the energy for maintaining the metabolic activity of retina. In the mitochondria, HK1 functions as a pro-survival factor to inhibit TNF-induced apoptotic signals. A missense mutation in hexokinase 1 (HK1) causes an autosomal dominant disorder, retinitis pigmentosa. It has been reported that porin-binding domain of HK1 actively participates in the mitochondrial integrity.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71394

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Comparer avec des articles similaires

Voir la comparaison complète

Montrer les différences

1 of 1

Cet article	HPA007043	SAB4300390	SAB4500211
Sigma-Aldrich HPA007044 Anti-HK1 antibody produced in rabbit	Sigma-Aldrich HPA007043 Anti-HK1 antibody produced in rabbit	Sigma-Aldrich SAB4300390 Anti-CHEK1 (Ab-317) antibody produced in rabbit	Sigma-Aldrich SAB4500211 Anti-CHK1 antibody produced in rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
Quality Level 100	Quality Level 100	Quality Level -	Quality Level 100
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line -
technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200	technique(s) immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200	technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): 1:50-1:100, western blot: 1:500-1:1000	technique(s) ELISA: 1:40000, western blot: 1:500-1:1000

Still not finding the right product?

Explore all of our products under Anti-HK1 antibody produced in rabbit

— ou —

Essayez notre Outil de sélection de produits pour affiner vos choix.

Classe de stockage

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c