Skip to Content
Merck
All Photos(4)

Documents

HPA005455

Sigma-Aldrich

Anti-NR5A2 antibody produced in rabbit

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-α-1-Fetoprotein transcription factor antibody produced in rabbit, Anti-B1-binding factor antibody produced in rabbit, Anti-CYP7A promoter-binding factor antibody produced in rabbit, Anti-Hepatocytic transcription factor antibody produced in rabbit, Anti-LRH-1 antibody produced in rabbit, Anti-Liver receptor homolog 1 antibody produced in rabbit, Anti-Orphan nuclear receptor NR5A2 antibody produced in rabbit, Anti-hB1F antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

GGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELL

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... NR5A2(2494)

Looking for similar products? Visit Product Comparison Guide

General description

Nuclear receptor subfamily 5, group A, member 2 (NR5A2) belongs to the family of nuclear receptors that function as regulatory transcription factors. It is related to SF-1/NR5A1 (mammalian steriodogenic factor-1), which regulates the development and functioning of adrenal glands and testis. NR5A2 is expressed in pancreas, liver and intestine, in adults. It is also expressed in breast adipose tissue and ovary. This protein was initially classified as an orphan nuclear receptor, but studies have shown that natural phospholipids, such as phosphatidylcholine or phosphatidylinositol are capable of binding to NR5A2.

Immunogen

Orphan nuclear receptor NR5A2 recombinant protein epitope signature tag (PrEST)

Application

Anti-NR5A2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Nuclear receptor subfamily 5, group A, member 2 (NR5A2) modulates embryonic development, lipid homeostasis, reproduction and energy metabolism, by regulating the expression of genes involved in these processes. It maintains pluripotency in undifferentiated embryonic stem cells by controlling Oct4 expression. In liver, pancreas and intestine, NR5A2 maintains bile acid and cholesterol homeostasis by regulating the expressions of the involved proteins. It also maintains the production of pancreatic enzymes. In ovary and breast adipose tissue, it modulates the biosynthesis of steroids. Various malignancies, such as breast, endometrial, intestinal and pancreatic cancer are linked to abnormalities in NR5A2 expression. It also plays a key role in sustaining estrogen biosynthesis and signaling in ER+ (estrogen receptor) breast cancer. In postmenopausal women, this protein regulates the expression of genes in osteoblasts, and thus, might be linked to osteoporosis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70746.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jia-Min B Pang et al.
Oncotarget, 8(48), 83626-83636 (2017-11-16)
The significance and regulation of liver receptor homologue 1 (LRH-1, NR5A2), a tumour-promoting transcription factor in breast cancer cell lines, is unknown in clinical breast cancers. This study aims to determine LRH-1/NR5A2 expression in breast cancers and relationship with DNA
Lijia Xiao et al.
Cancer management and research, 10, 2389-2400 (2018-08-21)
To explore potential therapeutic target is one of the areas of great interest in both clinical and basic hepatocellular carcinoma (HCC) studies. Nuclear receptor liver receptor homolog-1 (LRH-1, NR5A2) is proved to play a positive role in several cancers including
Stéphanie Bianco et al.
Cancer research, 74(7), 2015-2025 (2014-02-13)
Tumor characteristics are decisive in the determination of treatment strategy for patients with breast cancer. Patients with estrogen receptor α (ERα)-positive breast cancer can benefit from long-term hormonal treatment. Nonetheless, the majority of patients will develop resistance to these therapies.
Isidoro Cobo et al.
Nature, 554(7693), 533-537 (2018-02-15)
Chronic inflammation increases the risk of developing one of several types of cancer. Inflammatory responses are currently thought to be controlled by mechanisms that rely on transcriptional networks that are distinct from those involved in cell differentiation. The orphan nuclear
Cindy Benod et al.
The Journal of biological chemistry, 288(27), 19830-19844 (2013-05-15)
Liver receptor homolog 1 (nuclear receptor LRH-1, NR5A2) is an essential regulator of gene transcription, critical for maintenance of cell pluripotency in early development and imperative for the proper functions of the liver, pancreas, and intestines during the adult life.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service