Key Documents

Anti-STS antibody produced in rabbit

Name: Anti-STS antibody produced in rabbit
Brand: SIGMA
Price: 881 CAD

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ASC antibody produced in rabbit, Anti-Arylsulfatase C antibody produced in rabbit, Anti-Steroid sulfatase antibody produced in rabbit, Anti-Steryl-sulfatase precursor antibody produced in rabbit, Anti-Steryl-sulfate sulfohydrolase antibody produced in rabbit

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Please contact Customer Service for Availability	$881.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA002904

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

$881.00

Please contact Customer Service for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIY

UniProt accession no.

P08842

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... STS(412)

Description

Immunogen

Steryl-sulfatase precursor recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

Human steroid sulfatase (STS) plays a crucial role in regulating the formation of biologically active estrogens. The gene expression is induced by insulin-like growth factor (IGF)-II through a PI3-kinase/Akt-NF-κB signaling pathway in PC-3 cells. It may induce estrogen production and estrogen-mediated carcinogenesis. The gene may act as a promising target for treating estrogen-mediated carcinogenesis. STS expression can be decreased in the process of large intestinal carcinogenesis. Sodium butyrate (NaBu) may also increase its expression in CRC (colorectal carcinoma) cells.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST74049

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA000525	HPA004694	HPA001816
Sigma-Aldrich HPA002904 Anti-STS antibody produced in rabbit	Sigma-Aldrich HPA000525 Anti-ADSL antibody produced in rabbit	Sigma-Aldrich HPA004694 Anti-ARSD antibody produced in rabbit	Sigma-Aldrich HPA001816 Anti-SERPINC1 antibody produced in rabbit
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.